DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEFH and LamC

DIOPT Version :9

Sequence 1:NP_066554.2 Gene:NEFH / 4744 HGNCID:7737 Length:1020 Species:Homo sapiens
Sequence 2:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster


Alignment Length:554 Identity:146/554 - (26%)
Similarity:229/554 - (41%) Gaps:150/554 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    51 TRTSVSSVSASPSRFRGAGAASSTDSLDTLSNGPEGCMVAVATSRSEKEQLQALNDRFAGYIDKV 115
            :|.|.|:.....|.....||.|.|....|             :.:.|||:||.||||.|.|||::
  Fly    13 SRASTSTPVGGASTSSRVGATSPTSPTRT-------------SRQQEKEELQHLNDRLACYIDRM 64

Human   116 RQLEAHNRSLEGEAAALRQQQAGR--SAMGELYEREVREMRGAVLRLGAARGQLRLEQEHLLEDI 178
            |.||..|..|..| ..|.|....|  |.:..:||:|:...|..:......:.:|.::.:.|.|:.
  Fly    65 RNLENENSRLTQE-LNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEEN 128

Human   179 AHVRQRLDDEARQ----------------------------REEAEAAARALA------------ 203
            ..::.|||.:.::                            |::.|..|:.||            
  Fly   129 DDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFEDQAKELALENERLRRQLDD 193

Human   204 -RFAQEAEA-ARVDLQKKAQALQEECGYLRRHHQEEVGELLG--QIQGS---GAAQAQMQAETRD 261
             |...|||. |||||:.:.|:|:||..:..:.|.:|:.|...  ||:.|   |....|.:|:   
  Fly   194 LRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQYEAK--- 255

Human   262 ALKCDVTSALREIRAQLEGHAVQSTLQSEEWFRVRLDRLSEAAKVNTDAMRSAQ------EEITE 320
                 :..:|:|:|.|.||   |..:..||   :.|...:|...:...|.|:||      ||:..
  Fly   256 -----LQQSLQELRDQYEG---QMRINREE---IELLYDNEIQNLKAAANRAAQGSALATEEVRL 309

Human   321 YRRQLQARTTELEALKSTKDSLERQRSELEDRHQADIASYQEAIQQLDAELRNTKWEMAAQLREY 385
            .|.::.....:|:.|:.|...|..:..|||:....:...:.:.|..|:|||:..:.|||.||:||
  Fly   310 MRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEY 374

Human   386 QDLLNVKMALDIEIAAYRKLLEGEECRIGF-GPIPFSLPEGLPK----IPSVSTHIKVKSEEK-- 443
            |.|:::|::||:|||||.|||.|||.|:.. .|       |.|.    |.|..:|:...:..:  
  Fly   375 QGLMDIKVSLDLEIAAYDKLLCGEERRLNIESP-------GRPTTDSGISSNGSHLTASASSRSG 432

Human   444 -------------------IK----VVEKSEKETV--------------IVE------------E 459
                               :|    |:::||..|:              |:|            :
  Fly   433 RVTPSGRRSATPGISGSSAVKRRRTVIDESEDRTLSEYSVNAAAKGDLEIIEADVEGRFIKLHNK 497

Human   460 QTEETQVT----EEVTEEEEKEAKEEEGKEEEGG 489
            .|||..:|    ..:..:||...|...|.:..||
  Fly   498 GTEEINLTGWQLTRIAGDEELAFKFSRGSKVLGG 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEFHNP_066554.2 Head 1..100 11/48 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..83 6/24 (25%)
Filament 96..412 CDD:278467 113/370 (31%)
Coil 1A 101..132 16/30 (53%)
Linker 1 133..145 3/13 (23%)
Coil 1B 146..244 31/141 (22%)
Linker 12 245..266 5/23 (22%)
Coil 2A 267..288 7/20 (35%)
Linker 2 289..292 1/2 (50%)
Coil 2B 293..413 44/125 (35%)
BASP1 513..736 CDD:283191
LamCNP_001260974.1 Filament 45..401 CDD:278467 113/370 (31%)
ATP-synt_B <67..>142 CDD:304375 19/75 (25%)
MreC <178..>224 CDD:302802 15/45 (33%)
LTD 473..574 CDD:279300 12/59 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.