DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEFM and ifd-1

DIOPT Version :9

Sequence 1:NP_005373.2 Gene:NEFM / 4741 HGNCID:7734 Length:916 Species:Homo sapiens
Sequence 2:NP_001024830.1 Gene:ifd-1 / 187585 WormBaseID:WBGene00002057 Length:575 Species:Caenorhabditis elegans


Alignment Length:502 Identity:123/502 - (24%)
Similarity:223/502 - (44%) Gaps:83/502 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    55 SMLAPRLAYS---SAMLSSAESSL--DFSQSSSLLNGGSGPGGDYKLSRSNEKEQLQGLNDRFAG 114
            |.|.||:|::   |.::.|..::|  ..:.:.||...........:.:|..||.::..||:|.|.
 Worm     2 SKLNPRVAHNPVLSRIIESGRTNLPSGITSAGSLSAYAQAAAVTIRDNRDREKREIADLNNRLAR 66

Human   115 YIEKVHYLEQQNKEIEAEIQALRQKQASHAQLG---DAYDQEIRELRATLEMVNHEKAQVQLDSD 176
            |:|||.:||.||:.:|.:|...|  ||:|...|   |.||.|...| |||  |..::|:|.....
 Worm    67 YVEKVRFLEAQNRVLENDIGLFR--QAAHIHTGKVRDYYDAEKTSL-ATL--VREQEAKVSSAKQ 126

Human   177 H---LEEDI------------HRLKERFEEEARLR--DDTE---AAIRALRKDI-EEASLVKVEL 220
            :   ||.:|            ||.:.|.:::.:|:  .|.|   |.|:.|..|. :|.|.:|.|:
 Worm   127 NIRKLEPEITTAIRTLASSLEHRQRVRSDKKEQLKHLSDLESETAYIKRLINDCDDEKSHLKTEI 191

Human   221 D------KKVQSLQDEVAFLRSNHEEEVADLLAQIQASHITVE-----------------RKDYL 262
            .      |::.:|:|:.....|..:....|||.::.|:..|.|                 .:::.
 Worm   192 SRIRGEIKRILALRDKERNGFSRSQTAAQDLLKKLNATISTHEIAIREEINKARRDSTDKNREFF 256

Human   263 KTDISTALKEIRSQLESHSDQNMHQAEEWFKCRYAKLTEAAEQNKEAIRSAKEEIAEYRRQLQSK 327
            ..::..::||||.|.||.|.:.....|||:|.:..::.:.:|:.......|:||:...|..|...
 Worm   257 HRELHMSMKEIRDQFESDSKKARKTWEEWYKKKITEIKKRSEKFSLTQNQAREEVLRIRSLLNEL 321

Human   328 SIELESVRGTKESLERQLSDIEERHNHDLSSYQDTIQQLENELRGTKWEMARHLREYQDLLNVKM 392
            ..::.......::|.:::.|::.|.:.:|..::.::.:.|..:...:.|.|:...|.:.|:..::
 Worm   322 RTKISDADSMTQALSKRIEDMKFREDEELRMFEQSLTEKELAVTRMRDECAKLSVELETLVENQI 386

Human   393 ALDIEIAAYRKLLEGEETRFSTFAGSITGPLYTHRPPITISSKIQKPKVEAPKLKVQHKF----- 452
            .|..|||.||||:|..|...:::.....  :.|..|.:..||               |.:     
 Worm   387 NLRSEIAHYRKLMEQAENLRTSYQSDFV--IDTPSPLMRTSS---------------HHYGSSYS 434

Human   453 --VEEIIEETKVEDEKSEMEEALTAITEELAVSMKEEKKEAAEEKEE 497
              |.:...:| |..:..::..|.|..|::.....|.:.| ..|.|:|
 Worm   435 LNVRDTHNKT-VHHDNYDISSASTINTQQFRSYGKGDVK-IIEHKDE 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEFMNP_005373.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
Head 2..104 13/53 (25%)
Filament_head 10..78 CDD:282575 8/27 (30%)
Filament 100..411 CDD:278467 96/357 (27%)
Coil 1A 105..136 14/30 (47%)
Linker 1 137..149 5/14 (36%)
Coil 1B 150..248 34/124 (27%)
Linker 12 249..265 3/32 (9%)
Coil 2A 266..287 8/20 (40%)
Linker 2 288..291 1/2 (50%)
Coil 2B 292..412 26/119 (22%)
Tail 413..916 16/92 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 485..851 5/13 (38%)
6 X 13 AA approximate tandem repeats of K-S-P-V-[PS]-K-S-P-V-E-E-[KA]-[GAK] 614..691
ifd-1NP_001024830.1 Filament 53..404 CDD:278467 95/355 (27%)
MSP1_C <167..348 CDD:284802 40/180 (22%)
LTD 465..569 CDD:279300 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 181 1.000 Domainoid score I2296
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X62
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.