DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps28 and vps28

DIOPT Version :9

Sequence 1:NP_001260796.1 Gene:Vps28 / 47408 FlyBaseID:FBgn0021814 Length:210 Species:Drosophila melanogaster
Sequence 2:XP_012810557.1 Gene:vps28 / 549068 XenbaseID:XB-GENE-5776981 Length:247 Species:Xenopus tropicalis


Alignment Length:204 Identity:135/204 - (66%)
Similarity:171/204 - (83%) Gaps:0/204 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PELYEEVKLFRNAREREKYDNMADLYAIINTIQQLEKAYIRDCITPQEYTAACSKYLVQYKVAFK 70
            |||||||||::||||||||||||:|:|::.|:|.||||||:||::|.|||||||:.|||||.|||
 Frog    44 PELYEEVKLYKNAREREKYDNMAELFAVVKTLQALEKAYIKDCVSPSEYTAACSRLLVQYKAAFK 108

  Fly    71 QVQCDEFPSVETFVKKFRLDCPAALERIREDRPITIRDDKGNTSKCIAEIVSLFITIMDKLRLQI 135
            |||..|..|::.|.:|:|||||.|:|||:|||||||:|||||.::|||:|||||||:||||||:|
 Frog   109 QVQGAEVGSIDDFCRKYRLDCPLAMERIKEDRPITIKDDKGNLNRCIADIVSLFITVMDKLRLEI 173

  Fly   136 NTMDALQPDVKDLADNMNRLSLIPEDFDAKLKVEKWLGSLNEMQASDELSEGQVRQFLFDLESAY 200
            ..||.:|||:::|.:.|||:|.:|.||:.:.||.:||..|:.|.|||||.:.||||.||||||||
 Frog   174 RAMDEIQPDLRELMETMNRMSHLPPDFEGREKVSQWLQKLSSMSASDELDDSQVRQMLFDLESAY 238

  Fly   201 ADFNKLLHS 209
            ..||:.|||
 Frog   239 NAFNRFLHS 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps28NP_001260796.1 VPS28 27..207 CDD:397894 113/179 (63%)
vps28XP_012810557.1 VPS28 65..245 CDD:281926 113/179 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 247 1.000 Domainoid score I2119
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H69205
Inparanoid 1 1.050 292 1.000 Inparanoid score I2733
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1281819at2759
OrthoFinder 1 1.000 - - FOG0004132
OrthoInspector 1 1.000 - - oto105394
Panther 1 1.100 - - LDO PTHR12937
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2885
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.