DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps28 and VPS28

DIOPT Version :9

Sequence 1:NP_001260796.1 Gene:Vps28 / 47408 FlyBaseID:FBgn0021814 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_898880.1 Gene:VPS28 / 51160 HGNCID:18178 Length:233 Species:Homo sapiens


Alignment Length:175 Identity:110/175 - (62%)
Similarity:146/175 - (83%) Gaps:0/175 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PELYEEVKLFRNAREREKYDNMADLYAIINTIQQLEKAYIRDCITPQEYTAACSKYLVQYKVAFK 70
            |||||||||::||||||||||||:|:|::.|:|.||||||:||::|.|||||||:.|||||.||:
Human    18 PELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDCVSPSEYTAACSRLLVQYKAAFR 82

  Fly    71 QVQCDEFPSVETFVKKFRLDCPAALERIREDRPITIRDDKGNTSKCIAEIVSLFITIMDKLRLQI 135
            |||..|..|::.|.:|||||||.|:|||:|||||||:|||||.::|||::||||||:||||||:|
Human    83 QVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVMDKLRLEI 147

  Fly   136 NTMDALQPDVKDLADNMNRLSLIPEDFDAKLKVEKWLGSLNEMQA 180
            ..||.:|||:::|.:.|:|:|.:|.||:.:..|.:|..||...|:
Human   148 RAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWWVSLPARQS 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps28NP_001260796.1 VPS28 27..207 CDD:397894 91/154 (59%)
VPS28NP_898880.1 VPS28 39..187 CDD:309211 88/147 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160226
Domainoid 1 1.000 243 1.000 Domainoid score I2223
eggNOG 1 0.900 - - E1_KOG3284
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H69205
Inparanoid 1 1.050 287 1.000 Inparanoid score I2847
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53660
OrthoDB 1 1.010 - - D1281819at2759
OrthoFinder 1 1.000 - - FOG0004132
OrthoInspector 1 1.000 - - oto91627
orthoMCL 1 0.900 - - OOG6_103220
Panther 1 1.100 - - LDO PTHR12937
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1648
SonicParanoid 1 1.000 - - X2885
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.