DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATOH1 and Fer3

DIOPT Version :9

Sequence 1:NP_005163.1 Gene:ATOH1 / 474 HGNCID:797 Length:354 Species:Homo sapiens
Sequence 2:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster


Alignment Length:253 Identity:76/253 - (30%)
Similarity:101/253 - (39%) Gaps:99/253 - (39%)


- Green bases have known domain annotations that are detailed below.


Human    20 HRQP--QPHHLP----QP------PPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGI 72
            |..|  ||.::|    ||      ||||..|          |...::....||...|        
  Fly     3 HPHPIDQPTYMPDVPFQPLWGQEAPPPPIVP----------YQELIAGFPCTDLSLW-------- 49

Human    73 CTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVV 137
               :.:|.....|:         |...:|      |::|.:||||.                   
  Fly    50 ---QRSQVTPLVPQ---------RPSTNG------RANGSSSSSKK------------------- 77

Human   138 DELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQ 202
                 :|:|..|..|        |.|||.||||||..||.|||:||..:|:|..:|:||:.|||:
  Fly    78 -----TRRRVASMAQ--------RRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLR 129

Human   203 MAQIYINALSELLQ-TPS-------------GGEQPPPPPASCKSDH-HHLRTAASYE 245
            :|..||..::|||. |||             .|....||||.    | |||..||:|:
  Fly   130 LAITYIGFMAELLSGTPSNSHKSRSDVYGSMNGHHQAPPPAI----HPHHLHPAAAYQ 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATOH1NP_005163.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 13/46 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..122 8/30 (27%)
HLH 158..216 CDD:238036 30/57 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..277 15/45 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..354
Fer3NP_524322.1 HLH 87..135 CDD:278439 27/55 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.