DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATOH1 and tap

DIOPT Version :9

Sequence 1:NP_005163.1 Gene:ATOH1 / 474 HGNCID:797 Length:354 Species:Homo sapiens
Sequence 2:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster


Alignment Length:379 Identity:88/379 - (23%)
Similarity:126/379 - (33%) Gaps:138/379 - (36%)


- Green bases have known domain annotations that are detailed below.


Human    18 DHHRQPQPHHLPQP--------PPPPQPPATLQAREHPVYPPELSLLD-STDPRAWLAPTLQGIC 73
            |....|.| .:|||        .|...|||..           :.||| |::.......||....
  Fly    47 DFGTPPTP-AIPQPYSGGTWDAVPLSSPPAGF-----------VGLLDTSSNHSTRSGRTLVEHL 99

Human    74 TARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVD 138
            .:||...:. .|.|.::...:|.|                  ..:|.|          |....|.
  Fly   100 NSRATNGVF-DPPLTSTPVKSPED------------------PNAPRP----------KRKYAVG 135

Human   139 ELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQM 203
            :...:|.|:|:  ||..:::.||:.||.|||.|||.||.|.::||..:||...:.||:|.|.|:.
  Fly   136 KNRVTRSRSPT--QVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLPSLPEETKLTKIEILRF 198

Human   204 AQIYINALSELLQTPSGGE----------------------------QPPPPPASCKSDHHHLRT 240
            |..||.||.::|:  |||.                            .|.|.|.          .
  Fly   199 AHNYIFALEQVLE--SGGSINLDLEKLQNFTLSGERITKELFDALFVNPQPYPL----------F 251

Human   241 AASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAM 305
            ...:..|.|.|..|         |..|.|.|   ....|.:.||:...:|               
  Fly   252 GRMFPYGQGMAPLA---------QHQTAPAS---HAEQPPAMGGFQHGMD--------------- 289

Human   306 MAQKNLSPSLP------GSI-------LQPVQEENSKTSPRSHRSDGEFSPHSH 346
                  .|..|      ||:       .||.|..:.:.:|:...|..:||...:
  Fly   290 ------YPQQPPGFDFTGSMRFYHQQQQQPHQPHHLQPNPQQESSPQQFSQEKY 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATOH1NP_005163.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 10/44 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..122 3/30 (10%)
HLH 158..216 CDD:238036 27/57 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..277 14/88 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..354 11/48 (23%)
tapNP_524124.1 HLH 155..207 CDD:278439 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145435
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.