DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATOH1 and cato

DIOPT Version :9

Sequence 1:NP_005163.1 Gene:ATOH1 / 474 HGNCID:797 Length:354 Species:Homo sapiens
Sequence 2:NP_477344.1 Gene:cato / 36813 FlyBaseID:FBgn0024249 Length:189 Species:Drosophila melanogaster


Alignment Length:159 Identity:63/159 - (39%)
Similarity:82/159 - (51%) Gaps:45/159 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    63 AWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVDG---RGELVRRSSGGASSSKSPGPVKV 124
            |:|:|..|.:..|...|     .|||      |..|..|   :.:..|||:   |.:.|.|    
  Fly    40 AFLSPEWQFLDAAGGTQ-----TELG------PIMEAQGQHTQPQTKRRSN---SFTGSDG---- 86

Human   125 REQLCKLKGGVVVDELGCSRQRAPSSKQVN---GVQKQRRLAANARERRRMHGLNHAFDQLRNVI 186
                                 |..|.:|.|   .|||:||.|||||||:||:|||.||::||.|:
  Fly    87 ---------------------RKSSPEQTNLSPTVQKRRRQAANARERKRMNGLNAAFERLREVV 130

Human   187 PSFNNDKKLSKYETLQMAQIYINALSELL 215
            |:.:.|:||||:|||||||.||.||.:||
  Fly   131 PAPSIDQKLSKFETLQMAQSYILALCDLL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATOH1NP_005163.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..122 9/33 (27%)
HLH 158..216 CDD:238036 39/58 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..277 63/159 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..354
catoNP_477344.1 HLH 104..155 CDD:278439 34/50 (68%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 1 1.000 - - X4691
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.