DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATOH1 and amos

DIOPT Version :9

Sequence 1:NP_005163.1 Gene:ATOH1 / 474 HGNCID:797 Length:354 Species:Homo sapiens
Sequence 2:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster


Alignment Length:211 Identity:73/211 - (34%)
Similarity:95/211 - (45%) Gaps:59/211 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    34 PPQPPA--------TLQAREHPVYPPELSLLDSTDPRA--------WLAPT---LQGICTAR-AA 78
            |.:.||        |.|..|..:|..|.|..||....|        :..|:   |:.:..|: ..
  Fly    14 PDEAPAIPEFLSNDTFQQLEQLMYQQEFSTSDSQSDGANSCSLEMYYDTPSVLELEHMLNAQEQQ 78

Human    79 QYLLHSPELGASEAAAPR--------DEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGV 135
            |:.|.:..||.::..:||        ...|.....:..|:..||||.|                 
  Fly    79 QHHLQANPLGKNQGRSPRYWNKQQRSKPYDKLSTSMSSSTSSASSSSS----------------- 126

Human   136 VVDELGCSRQRAPSSKQVNG-VQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYE 199
                         ||....| |.|:|||||||||||||:.||.|||:||:|:||..:|::|||||
  Fly   127 -------------SSAGFGGEVLKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYE 178

Human   200 TLQMAQIYINALSELL 215
            ||||||.||..|..||
  Fly   179 TLQMAQAYIGDLVTLL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATOH1NP_005163.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 8/28 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..122 9/38 (24%)
HLH 158..216 CDD:238036 41/58 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..277 73/211 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..354
amosNP_477446.1 HLH 137..195 CDD:238036 41/58 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145422
Domainoid 1 1.000 79 1.000 Domainoid score I8721
eggNOG 1 0.900 - - E1_KOG4395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto89492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.