Sequence 1: | NP_005163.1 | Gene: | ATOH1 / 474 | HGNCID: | 797 | Length: | 354 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001188830.1 | Gene: | Oli / 35066 | FlyBaseID: | FBgn0032651 | Length: | 232 | Species: | Drosophila melanogaster |
Alignment Length: | 255 | Identity: | 75/255 - (29%) |
---|---|---|---|
Similarity: | 97/255 - (38%) | Gaps: | 84/255 - (32%) |
- Green bases have known domain annotations that are detailed below.
Human 23 PQPHHLPQPP-----------PPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTAR 76
Human 77 AAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSP-GPVKVREQLCKLKGG---VVV 137
Human 138 DELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNND--KKLSKYET 200
Human 201 LQMAQIYI----NALSEL------LQTPSG--------------------GEQPPPPPAS 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ATOH1 | NP_005163.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..55 | 10/42 (24%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 91..122 | 6/31 (19%) | |||
HLH | 158..216 | CDD:238036 | 35/69 (51%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 216..277 | 6/35 (17%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 312..354 | ||||
Oli | NP_001188830.1 | HLH | 134..188 | CDD:197674 | 30/53 (57%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |