DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATOH1 and Oli

DIOPT Version :9

Sequence 1:NP_005163.1 Gene:ATOH1 / 474 HGNCID:797 Length:354 Species:Homo sapiens
Sequence 2:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster


Alignment Length:255 Identity:75/255 - (29%)
Similarity:97/255 - (38%) Gaps:84/255 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    23 PQPHHLPQPP-----------PPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTAR 76
            |...|:|.||           |...||.::..|..|        |.|.....:.|   ||     
  Fly    14 PNHGHMPIPPTANMLGGQHPAPTASPPQSVPGRRTP--------LGSVGLGGFYA---QG----- 62

Human    77 AAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSP-GPVKVREQLCKLKGG---VVV 137
                      :|.|: ..|.||          :..|.|:.:.| .|.........:.||   |.|
  Fly    63 ----------MGMSQ-QPPTDE----------NKPGPSAPEKPLSPTAAAIAAIAISGGTTTVAV 106

Human   138 DELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNND--KKLSKYET 200
            ...|.|...:.|.||.|...|..||..|||||||||.||.|.|:||:|||..::.  :||||..|
  Fly   107 SSGGASGSGSNSGKQKNRQGKTVRLNINARERRRMHDLNDALDELRSVIPYAHSPSVRKLSKIAT 171

Human   201 LQMAQIYI----NALSEL------LQTPSG--------------------GEQPPPPPAS 230
            |.:|:.||    |||.||      :|:.:|                    |....||.:|
  Fly   172 LLLAKNYILMQQNALEELRRLLAYIQSTTGAAPLDLGAFPAAAKLQALLQGPHNEPPTSS 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATOH1NP_005163.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 10/42 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..122 6/31 (19%)
HLH 158..216 CDD:238036 35/69 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..277 6/35 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..354
OliNP_001188830.1 HLH 134..188 CDD:197674 30/53 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.