DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATOH1 and CG33557

DIOPT Version :9

Sequence 1:NP_005163.1 Gene:ATOH1 / 474 HGNCID:797 Length:354 Species:Homo sapiens
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:123 Identity:41/123 - (33%)
Similarity:60/123 - (48%) Gaps:27/123 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   109 SSGGASSSKSPGPVKVREQLCKLKGGVVVD----ELGCSRQRAPSSKQVNGVQKQR--RLAANAR 167
            |||.||.|                 |...|    ::|  ::..|..::..|..::|  |...|||
  Fly    24 SSGSASGS-----------------GAAADSEDSQIG--QEANPGGQENQGNHRRRPPRQKINAR 69

Human   168 ERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQPP 225
            ||.|...:|.|::.|||:||:...::||||.|.:::|..||..||..|:|  |.|..|
  Fly    70 ERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLET--GTECQP 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATOH1NP_005163.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..122 6/12 (50%)
HLH 158..216 CDD:238036 25/59 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..277 4/10 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..354
CG33557NP_001014730.1 HLH 67..119 CDD:197674 24/51 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.