DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATOH1 and sc

DIOPT Version :9

Sequence 1:NP_005163.1 Gene:ATOH1 / 474 HGNCID:797 Length:354 Species:Homo sapiens
Sequence 2:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster


Alignment Length:276 Identity:69/276 - (25%)
Similarity:93/276 - (33%) Gaps:96/276 - (34%)


- Green bases have known domain annotations that are detailed below.


Human   102 RGELVRRSSGGASS---SKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLA 163
            ||..:.|.|...||   ..||.|..|.:                       |:.|     |||  
  Fly    70 RGMALTRCSESVSSLSPGSSPAPYNVDQ-----------------------SQSV-----QRR-- 104

Human   164 ANARERRRMHGLNHAFDQLRNVIP-SFNND----------KKLSKYETLQMAQIYINALSELLQT 217
             |||||.|:..:|::|.:||..|| |...|          ||:||.:||::|..||..|.:|:..
  Fly   105 -NARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRLQDLVDD 168

Human   218 PSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASA 282
            .:||..                              .||..|....|......|..:..|:..|:
  Fly   169 LNGGSN------------------------------IGANNAVTQLQLCLDESSSHSSSSSTCSS 203

Human   283 GGYSV------------QLDALHFSTFEDSALTAMMAQKNL-SPSLPGSILQPVQEENSKTSPRS 334
            .|::.            |...|....|....|||:....|| ..|:||.....|  ..||.....
  Fly   204 SGHNTYYQNTISVSPLQQQQQLQRQQFNHQPLTALSLNTNLVGTSVPGGDAGCV--STSKNQQTC 266

Human   335 HRSDGEFSPHSHYSDS 350
            |      ||.|.::.|
  Fly   267 H------SPTSSFNSS 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATOH1NP_005163.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..122 8/22 (36%)
HLH 158..216 CDD:238036 28/68 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..277 7/60 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..354 11/39 (28%)
scNP_476803.1 HLH 105..163 CDD:278439 23/57 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.