powered by:
Protein Alignment Tor and CG30184
DIOPT Version :9
Sequence 1: | NP_001260427.1 |
Gene: | Tor / 47396 |
FlyBaseID: | FBgn0021796 |
Length: | 2471 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_726341.1 |
Gene: | CG30184 / 246506 |
FlyBaseID: | FBgn0050184 |
Length: | 223 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 19/71 - (26%) |
Similarity: | 28/71 - (39%) |
Gaps: | 10/71 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 168 TYFYQHILTFFEVIFNAIFDPKPAIRESA--GEALRAALIVT-------AQRESTKQSSEPQWYR 223
||....|:.|..:| .|.:..:|.::..| |..|....:|| |..|..:....|.:|.
Fly 46 TYGGSVIICFISLI-GAFYAERPTMKHEALFGGILGGLHMVTVYANMYVATLEEFRTERWPSFYA 109
Fly 224 ICYDEA 229
.|.|.|
Fly 110 CCRDNA 115
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5032 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.