DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tor and CG30184

DIOPT Version :9

Sequence 1:NP_001260427.1 Gene:Tor / 47396 FlyBaseID:FBgn0021796 Length:2471 Species:Drosophila melanogaster
Sequence 2:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster


Alignment Length:71 Identity:19/71 - (26%)
Similarity:28/71 - (39%) Gaps:10/71 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 TYFYQHILTFFEVIFNAIFDPKPAIRESA--GEALRAALIVT-------AQRESTKQSSEPQWYR 223
            ||....|:.|..:| .|.:..:|.::..|  |..|....:||       |..|..:....|.:|.
  Fly    46 TYGGSVIICFISLI-GAFYAERPTMKHEALFGGILGGLHMVTVYANMYVATLEEFRTERWPSFYA 109

  Fly   224 ICYDEA 229
            .|.|.|
  Fly   110 CCRDNA 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TorNP_001260427.1 TEL1 308..2471 CDD:227365
HEAT repeat 632..658 CDD:293787
HEAT repeat 668..698 CDD:293787
HEAT repeat 706..736 CDD:293787
HEAT repeat 749..780 CDD:293787
HEAT repeat 798..823 CDD:293787
DUF3385 831..999 CDD:288698
HEAT repeat 841..870 CDD:293787
HEAT repeat 880..917 CDD:293787
HEAT repeat 925..954 CDD:293787
Rapamycin_bind 1937..2034 CDD:285924
PIKKc_TOR 2075..2353 CDD:270713
FATC 2440..2471 CDD:280430
CG30184NP_726341.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.