DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and ISX

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001290437.1 Gene:ISX / 91464 HGNCID:28084 Length:245 Species:Homo sapiens


Alignment Length:212 Identity:72/212 - (33%)
Similarity:97/212 - (45%) Gaps:45/212 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 GVGIQG---AAGTAGGVAAPAAKKDGSSSKKKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYP 329
            |.|.:|   ||.:..|:..|  .||.....:|      .|::.|||||..||.|||:.|....||
Human    51 GPGEEGPGEAAASGSGLEKP--PKDQPQEGRK------SKRRVRTTFTTEQLHELEKIFHFTHYP 107

  Fly   330 DVFAREELAIKLNLSESRVQVWFQNRRAKWRKHE------PPRKTGYIKTSTP-------PTATL 381
            ||..|.:||.::||.|:|||:||||:||||||.|      .|::......:.|       ||.|.
Human   108 DVHIRSQLAARINLPEARVQIWFQNQRAKWRKQEKIGNLGAPQQLSEASVALPTNLDVAGPTWTS 172

  Fly   382 NP-GTLAPPFTSYPQTTTVTPPGSMDSWTSYQTPYELTPQFSLLSPAASPYGTYSGQYGAYVHES 445
            .. ..||||        |...|.:.|...|...|..:|     |.| |.|:.|.... |..:|::
Human   173 TALRRLAPP--------TSCCPSAQDQLASAWFPAWIT-----LLP-AHPWETQPVP-GLPIHQT 222

  Fly   446 -----QLFPMRHYEYGS 457
                 .:.|..|.::||
Human   223 CIPVLCILPPPHPKWGS 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 26/46 (57%)
ISXNP_001290437.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..86 11/42 (26%)
Homeobox 86..138 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.