DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and YHP1

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_010739.3 Gene:YHP1 / 852062 SGDID:S000002859 Length:353 Species:Saccharomyces cerevisiae


Alignment Length:261 Identity:64/261 - (24%)
Similarity:100/261 - (38%) Gaps:71/261 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 HPLNGKLDYSSSPKDQYEPQQLQHLYGGSPHHLDHLDHGSDGLLQDSSPVMINGGSAGGKLKKPD 228
            |.:...::...||.|:..|::      .||..:|.|   |..:....:|           |.||.
Yeast    51 HIVRPVVNIYKSPCDEERPKR------KSPQAVDFL---SQRVTTSMTP-----------LSKPK 95

  Fly   229 EM------------CSQLEAGGAGVTPPSSSSTVVNGTTNGTGNANSSSSAGVGIQGAAGTAGGV 281
            ::            ||:.:       ||.|                ..|...|.|......|..|
Yeast    96 KLSSHSPFTPTVRVCSKEQ-------PPQS----------------MHSYKKVNILTPLSAAKAV 137

  Fly   282 AAPAAKKDGSSS------------KK--KGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVF 332
            ..|..:|:...|            ||  |.|...:.::|.|.| ::|:|..|:.||:..|.|:..
Yeast   138 LTPTTRKEKKRSFAFITHSQETFPKKEPKIDNARLARRKRRRT-SSYELGILQTAFDECPTPNKA 201

  Fly   333 AREELAIKLNLSESRVQVWFQNRRAKWRKHEPPRKTGYIKT-STPPTATLNPGTLAPPFTSYPQT 396
            .|.||:.:.|:||..||:||||:|...:||:....|.:.|. |....:.::....|...||.|.:
Yeast   202 KRIELSEQCNMSEKSVQIWFQNKRQAAKKHKNSGNTSHCKVHSNDSMSMISYSDAALEITSTPTS 266

  Fly   397 T 397
            |
Yeast   267 T 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 20/46 (43%)
YHP1NP_010739.3 COG5576 123..278 CDD:227863 44/146 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.