DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and HB-1

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_174164.2 Gene:HB-1 / 839740 AraportID:AT1G28420 Length:1705 Species:Arabidopsis thaliana


Alignment Length:351 Identity:86/351 - (24%)
Similarity:133/351 - (37%) Gaps:56/351 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 KKDGSSSKKKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVW 351
            |.|.:||.|.|     :.|..|...|.:|||.||:.:....||....|.||:.||:||:.::|:|
plant    27 KIDNNSSSKDG-----RVKPKRQMKTPFQLETLEKVYSEEKYPSEATRAELSEKLDLSDRQLQMW 86

  Fly   352 FQNRRAKWRKHEPPRKTGYIKTSTPPTATLNPGTLAPPFTSYPQTTTVTPPGSMDSWTSYQTPYE 416
            |.:||.|.:|.....|.  :|:|.....:.:...|.....|.|:..:.:..||....:.|.....
plant    87 FCHRRLKDKKDGQSNKP--VKSSVAAVQSASVNELPAAAGSVPEQDSRSDSGSESGCSPYSNSRR 149

  Fly   417 LTPQFSLLSPA-ASPYGTYSGQYGAYVHESQLFPMRH-------YEYGSPTRMEMGATTGSVAGN 473
            .....|..|.| ...|.|    .|...:||:|..|.|       .:.|.|.|.:     |.:.|.
plant   150 NFASGSSSSRAELDEYET----MGKPSYESRLSTMVHRAIVCIEAQLGEPLRDD-----GPILGM 205

  Fly   474 GDESVANGGSYQTAELQTAQQQQLA-----------DGTLVTVHAHQQQQQQQQQLNGKYLSAEE 527
            ..:.:. .|::.|   ..|.|:.|.           |......||..:...:||.|:........
plant   206 EFDPLP-PGAFGT---PIAMQKHLLHPYESDLYERHDPRPRRSHAAARSFHEQQSLDDPSSFTPN 266

  Fly   528 AKYVHLQCHQSGGGLELSPGASCHLVEAQG---QHYVTTATGGAASAGGTSSDDNDSGGMQTVIK 589
            ....:.:.|..|...|::.......:.|.|   :.|||  .|.|:....||..|     |.:.|:
plant   267 MYERYSENHARGMDYEVARSRISSFMHANGPVPRSYVT--PGHASRNCSTSQQD-----MPSPIE 324

  Fly   590 SEEVSQQQQQQQGQS-------YVLP 608
            |.....:...::..|       |:||
plant   325 SAHHGDRFLLEKDSSVLGTEDPYLLP 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 20/46 (43%)
HB-1NP_174164.2 Homeobox 42..95 CDD:278475 22/52 (42%)
DDT 550..605 CDD:280886
HARE-HTH 731..799 CDD:282869
WHIM1 934..979 CDD:292246
WHIM2 1100..1137 CDD:292247
WHIM3 1139..1172 CDD:292248
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.