DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and RLT2

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001318738.1 Gene:RLT2 / 834441 AraportID:AT5G44180 Length:1694 Species:Arabidopsis thaliana


Alignment Length:371 Identity:83/371 - (22%)
Similarity:131/371 - (35%) Gaps:107/371 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 DGSSSKKKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQ 353
            :|.|.|...:..|.:.|..|...||.|||.||..:...|||....|.:|::|||||:.::|:||.
plant     2 EGGSEKTTPEGCGGESKSKRKMKTAAQLEVLENTYSAEPYPSEAIRADLSVKLNLSDRQLQMWFC 66

  Fly   354 NRRAKWRKHEPPRKTGYIKTSTPPTATLNPGTLAPPFTSYPQTTTVTPPGSMDSWTSYQTPYELT 418
            :||.|.||...|.|.                          |...:..|.:|:||.......:|.
plant    67 HRRLKERKSTTPSKR--------------------------QRKELVTPTAMESWEPPVNAGDLV 105

  Fly   419 PQFSLLSPAAS-----------------------PYGTYSGQYGAYVHES------QLFPMRHYE 454
            ....|.|..|:                       ..|....|.|..:.::      :..|:....
plant   106 AGNELDSRRAARGSGGSGVTVVRRFNEPSSAEVRAIGYVEAQLGERLRDNGPVLGMEFDPLPPGA 170

  Fly   455 YGSPTRM--EMGATTGSVAGN----GD-----ESVANGGSYQ-TAEL---QTAQQQQLA------ 498
            :|.|..|  ...||..:...|    .|     :.|.....|| ..||   :|...::::      
plant   171 FGMPIEMPSHRKATRQAFETNIYVRSDVKPIKDHVRPIREYQFIPELPSSRTDHSERVSPSHHFG 235

  Fly   499 ---DGTLVTVHA----HQQQQQQQQQLNGKYLSAEEAKYVHLQCHQSGGGLELSPGASCHLVEAQ 556
               ||:::.|.|    |:..          |..:.:...::|..||...|...||    :|||..
plant   236 VPLDGSVMRVSAVSAGHRDD----------YKISPQIPNLNLATHQGKPGHVYSP----NLVEYD 286

  Fly   557 GQH---YVTTATG-------GAASAGGTSSDDNDSGGMQTVIKSEE 592
            ..:   |:.||..       .:....|...:|:|:..::...|:||
plant   287 SPYQKSYMDTAAQVHDDPFVKSEREVGNEDEDDDALQLERHRKNEE 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 22/46 (48%)
RLT2NP_001318738.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.