DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and HDG1

DIOPT Version :10

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_191674.1 Gene:HDG1 / 825287 AraportID:AT3G61150 Length:808 Species:Arabidopsis thaliana


Alignment Length:145 Identity:43/145 - (29%)
Similarity:64/145 - (44%) Gaps:25/145 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 GGAGVTP----PSSSSTVVNG-TTNG---------TGNANSSSSAGVGIQGAAGTAGGVAAPAAK 287
            |.|.:.|    |.|||.:..| .|||         ..|.:..||.|..::..:.:....|.....
plant    36 GSAAIAPSQSLPFSSSGLSLGLQTNGEMSRNGEIMESNVSRKSSRGEDVESRSESDNAEAVSGDD 100

  Fly   288 KDGSSSKKKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWF 352
            .|.|.       ..:||||.....|..|:::||..|:...:||...|.:|:.:|||...:|:.||
plant   101 LDTSD-------RPLKKKKRYHRHTPKQIQDLESVFKECAHPDEKQRLDLSRRLNLDPRQVKFWF 158

  Fly   353 QNRRAKWR----KHE 363
            ||||.:.:    :||
plant   159 QNRRTQMKTQIERHE 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeodomain 313..361 CDD:459649 18/51 (35%)
HDG1NP_191674.1 COG5576 69..185 CDD:227863 32/112 (29%)
Homeodomain 111..166 CDD:459649 21/54 (39%)
START_ArGLABRA2_like 314..537 CDD:176884
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.