DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and ALX1

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_008913.2 Gene:ALX1 / 8092 HGNCID:1494 Length:326 Species:Homo sapiens


Alignment Length:326 Identity:95/326 - (29%)
Similarity:138/326 - (42%) Gaps:86/326 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 PQQLQHLYGGSPHHLDH----LDHGSDGLLQDSSPVMINGGSAG------GKLKKPDEMCSQLEA 236
            |.:....|.|:...|:|    ||:.|          ..:..|||      |.|.:.:... :||.
Human    14 PSKNSDFYMGAGGPLEHVMETLDNES----------FYSKASAGKCVQAFGPLPRAEHHV-RLER 67

  Fly   237 GGAGVTPPSSSSTVVNGTTNGTG------------NANSSSSAGV-GIQGAAGTAGGVAAPAAKK 288
                 |.|...|:|..|.|...|            |.||...:.| |:|           ...:.
Human    68 -----TSPCQDSSVNYGITKVEGQPLHTELNRAMDNCNSLRMSPVKGMQ-----------EKGEL 116

  Fly   289 DGSSSKKKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQ 353
            |....|...:.:..||::.|||||:.||||||:.|::..||||:.||:||::..|:|:|||||||
Human   117 DELGDKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQ 181

  Fly   354 NRRAKWRKHEPPRKTGYIKTSTPPTATLNPGTLAPPFTSYPQ----------------TTTVTPP 402
            ||||||||.|   :.|.|:.:....|.....::.|...||||                |:.:.|.
Human   182 NRRAKWRKRE---RYGQIQQAKSHFAATYDISVLPRTDSYPQIQNNLWAGNASGGSVVTSCMLPR 243

  Fly   403 GSMDSWTSYQTPYELTPQFSLLSPAASPYGTYSGQYGAYVHESQLFPMRHYEYGSPTRMEMGATT 467
            .:    :|..|||..:|:      ..|.|..:|.....:.|    .|:.::...|   :..|||.
Human   244 DT----SSCMTPYSHSPR------TDSSYTGFSNHQNQFSH----VPLNNFFTDS---LLTGATN 291

  Fly   468 G 468
            |
Human   292 G 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 29/46 (63%)
ALX1NP_008913.2 Homeobox 135..189 CDD:365835 35/53 (66%)
Transactivation domain. /evidence=ECO:0000250|UniProtKB:Q63087 192..326 25/118 (21%)
OAR 302..320 CDD:367680
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.