DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and Isx

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001281207.1 Gene:Isx / 71597 MGIID:1918847 Length:242 Species:Mus musculus


Alignment Length:167 Identity:60/167 - (35%)
Similarity:83/167 - (49%) Gaps:35/167 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 PAAK-----KDGSSSKKKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNL 343
            |.:|     :|....:||      .|::.|||||..||:|||:.|....|||:..|.:||.::||
Mouse    59 PGSKLERPPQDQPQEEKK------NKRRVRTTFTTEQLQELEKLFHFTHYPDIHVRSQLASRINL 117

  Fly   344 SESRVQVWFQNRRAKWRKHE------PPRKTG---------YIKTSTPPTATLNPGTLAPPFTSY 393
            .|:|||:||||:||||||.|      .|::.|         ||.||.....||:.   :.||...
Mouse   118 PEARVQIWFQNQRAKWRKQEKSGNLSAPQQPGSCADTHCYDYIGTSHRMLPTLSD---SAPFKLV 179

  Fly   394 PQTTTVTPPGSM----DSWTSYQTPYELTPQFSLLSP 426
            |.|.:..|...|    .:|.|:  |..|.|...:.:|
Mouse   180 PYTDSPCPMAPMGPTAPAWPSH--PASLCPYLHVPTP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 25/46 (54%)
IsxNP_001281207.1 Homeobox 82..134 CDD:278475 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.