DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and shox

DIOPT Version :10

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_005167911.1 Gene:shox / 664748 ZFINID:ZDB-GENE-051030-21 Length:304 Species:Danio rerio


Alignment Length:156 Identity:60/156 - (38%)
Similarity:81/156 - (51%) Gaps:15/156 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 KKDGSSSKKKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVW 351
            ||:...|:.:...:.:|::::||.||..||.||||.|:...|||.|.||||:.:|.|||:|||||
Zfish    92 KKEDVKSEDEDAQSKLKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVW 156

  Fly   352 FQNRRAKWRKHEPPRKTGYI-KTSTPPTAT-----LNPGTLAPPFTSYPQTTTVTPPGS-----M 405
            |||||||.||.|.....|.| .|::...|.     :|.|.|..||........:...|:     :
Zfish   157 FQNRRAKCRKQENQMHKGVILGTASHLDACRVAPYVNMGALRMPFQQVQAQLQLEGVGTHSHPHL 221

  Fly   406 DSWTSYQTPYEL--TPQFSLLSPAAS 429
            ....:...||.:  .|.|.|  |.||
Zfish   222 HPHLAAHAPYLMFPPPPFGL--PIAS 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeodomain 313..361 CDD:459649 31/47 (66%)
shoxXP_005167911.1 SCP-1 <1..>145 CDD:114219 23/52 (44%)
Homeodomain 110..166 CDD:459649 35/55 (64%)

Return to query results.
Submit another query.