DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and shox

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_005167911.1 Gene:shox / 664748 ZFINID:ZDB-GENE-051030-21 Length:304 Species:Danio rerio


Alignment Length:156 Identity:60/156 - (38%)
Similarity:81/156 - (51%) Gaps:15/156 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 KKDGSSSKKKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVW 351
            ||:...|:.:...:.:|::::||.||..||.||||.|:...|||.|.||||:.:|.|||:|||||
Zfish    92 KKEDVKSEDEDAQSKLKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVW 156

  Fly   352 FQNRRAKWRKHEPPRKTGYI-KTSTPPTAT-----LNPGTLAPPFTSYPQTTTVTPPGS-----M 405
            |||||||.||.|.....|.| .|::...|.     :|.|.|..||........:...|:     :
Zfish   157 FQNRRAKCRKQENQMHKGVILGTASHLDACRVAPYVNMGALRMPFQQVQAQLQLEGVGTHSHPHL 221

  Fly   406 DSWTSYQTPYEL--TPQFSLLSPAAS 429
            ....:...||.:  .|.|.|  |.||
Zfish   222 HPHLAAHAPYLMFPPPPFGL--PIAS 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 31/46 (67%)
shoxXP_005167911.1 Homeobox 112..165 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.