DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and SHOX2

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_003021.3 Gene:SHOX2 / 6474 HGNCID:10854 Length:355 Species:Homo sapiens


Alignment Length:342 Identity:90/342 - (26%)
Similarity:128/342 - (37%) Gaps:96/342 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 GKLKKPDEMCSQLEAGGAGVTPPSSSSTVVNGTTNGTGNANSSSSAGVGIQGAAGTAGGVAAPAA 286
            |.|:...|.....|||....:.|:..: ...|...|.|........|||..||.|.|||..:|..
Human    32 GPLRGAKEPTGCTEAGRDDRSSPAVRA-AGGGGGGGGGGGGGGGGGGVGGGGAGGGAGGGRSPVR 95

  Fly   287 KKDGSSSKKKGDPNG-------------------------------------------------- 301
            :.|..::::..:|..                                                  
Human    96 ELDMGAAERSREPGSPRLTEGRRKPTKAEVQATLLLPGEAFRFLVSPELKDRKEDAKGMEDEGQT 160

  Fly   302 -IKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKHEPP 365
             ||::::||.||..||.||||.|:...|||.|.||||:.:|.|||:||||||||||||.||.|..
Human   161 KIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQ 225

  Fly   366 RKTGYIKTSTPP------TATLNPGTLAPPFTSYPQTTTVTPPG-------SMDSWTSYQTPYEL 417
            ...|.:..:...      ...:|.|.|..|| .......|||..       .:||..:: ..:.|
Human   226 LHKGVLIGAASQFEACRVAPYVNVGALRMPF-QQDSHCNVTPLSFQVQAQLQLDSAVAH-AHHHL 288

  Fly   418 TPQFSLLSPAASPYGTYSGQYGAYVHESQLFPMRHYEYGSPTRMEMGATTGSVAGNGDESVANGG 482
            .|..:    |.:||              .:||..  .:|.|.     ||..:.:.:....||...
Human   289 HPHLA----AHAPY--------------MMFPAP--PFGLPL-----ATLAADSASAASVVAAAA 328

  Fly   483 SYQTAELQTAQQQQLAD 499
            :.:|    |::...:||
Human   329 AAKT----TSKNSSIAD 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 31/46 (67%)
SHOX2NP_003021.3 Homeobox 167..220 CDD:306543 35/52 (67%)
OAR 335..351 CDD:309087 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.