DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and ALX4

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_068745.2 Gene:ALX4 / 60529 HGNCID:450 Length:411 Species:Homo sapiens


Alignment Length:439 Identity:127/439 - (28%)
Similarity:174/439 - (39%) Gaps:136/439 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GGGGAGSGG--AGGSPNYVTKLDFVNKMGCYSPSQKYEYISAPQKLVEQQQQQQHHHQHHQHYTA 131
            |.|.|.|..  ..|..:..|.|:  :..|......|::    ||....|.|              
Human    56 GFGDAKSRARYGAGQQDLATPLE--SGAGARGSFNKFQ----PQPSTPQPQ-------------- 100

  Fly   132 TPPPSHNGILLHKQSSQQQQQQQQQLVGILDYHPLNGKLDYSSSPKDQYEPQQLQHLYGGSPHHL 196
             |||             |.|.||||                     .|.:|....|||       
Human   101 -PPP-------------QPQPQQQQ---------------------PQPQPPAQPHLY------- 123

  Fly   197 DHLDHGS-----DGLLQDSSPVMINGGSAG--GKLKKPDEMCSQLEAG-GAGVTPPSSSSTVVNG 253
              |..|:     ||.|:      :..||:|  ..|:.|   |...|:. |....||.|.:..::.
Human   124 --LQRGACKTPPDGSLK------LQEGSSGHSAALQVP---CYAKESSLGEPELPPDSDTVGMDS 177

  Fly   254 TTNGTGNANSSSSAGVGIQGAAGTAGG-VAAPAAKKDGSSSKKKGDPNGIKKKKTRTTFTAYQLE 317
            :......|        |::|....|.. :.:|..|.|..|:|.       ||::.|||||:||||
Human   178 SYLSVKEA--------GVKGPQDRASSDLPSPLEKADSESNKG-------KKRRNRTTFTSYQLE 227

  Fly   318 ELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKHEPPRKTGYIKT--STP---P 377
            |||:.|::..||||:|||:||::.:|:|:|||||||||||||||.|...:...::|  ||.   |
Human   228 ELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQQVRTHFSTAYELP 292

  Fly   378 TAT--------LNPGTLAPPFTSYPQTTTVTPPGSMDSWTSYQTPYELTP--------QFSLLSP 426
            ..|        .||..|.....:.|....|.|   .|...:..:|:...|        .|..:|.
Human   293 LLTRAENYAQIQNPSWLGNNGAASPVPACVVP---CDPVPACMSPHAHPPGSGASSVTDFLSVSG 354

  Fly   427 AASPYG-TYSGQ-YGAYVHESQLFP-MRHYEY-GSPTRMEMGATTGSVA 471
            |.|..| |:.|. :||    :.|.| :..||. |.|.|     .|.|:|
Human   355 AGSHVGQTHMGSLFGA----ASLSPGLNGYELNGEPDR-----KTSSIA 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 31/46 (67%)
ALX4NP_068745.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..145 29/139 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..219 11/49 (22%)
Homeobox 218..270 CDD:278475 36/51 (71%)
OAR 387..404 CDD:281777 4/13 (31%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 391..404 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.