DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and CG34367

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster


Alignment Length:469 Identity:104/469 - (22%)
Similarity:159/469 - (33%) Gaps:163/469 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SVHELCSQQQQQQQQQRLPDCNTILPNGGGGGAGSGGAGGSPNYVTKLDFVNKMGCYSPSQKYEY 105
            |||.|.:.....:.::.....|:|..|....|........|......:|..:    .|.|:....
  Fly    20 SVHALFNSMTGARLKKPTEVKNSIFINSISSGGSYADTCASGEESVDIDITD----LSVSESNTI 80

  Fly   106 ISAPQKLVEQQQQQQHHHQHHQH---YTATPPPSHNGILLHKQSSQQQQQQQQQLVGILDYHPLN 167
            ::     ::.:..::.|.|..:|   |:.:|       .|||.:.:.:.:...          ::
  Fly    81 LA-----IDPEPTEESHSQREEHVETYSLSP-------TLHKAAVEPKPKNWL----------IS 123

  Fly   168 GKLDYSSSPKDQYEPQQLQHLYGGSPHHLDHLDHGSDGLLQDSSPVMINGGSAGGKLKKPDEMCS 232
            ..||..|.|:|                                                      
  Fly   124 EDLDVDSQPED------------------------------------------------------ 134

  Fly   233 QLEAGGAGVTPPSSSSTVVNGTTNGTGNANSSSSAGVGIQGAAGTAGGVAAP--------AAKKD 289
                       |..|.......|..|.::|:..                .||        ....:
  Fly   135 -----------PKMSGLPTASITECTEDSNTPK----------------LAPDKPLLPEECVSPE 172

  Fly   290 GSSSKKKGDP-----NGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQ 349
            .|.:::..||     ...|::::||.||..||.||||.||...|||.|.||||:.:|.|||:|||
  Fly   173 PSRNREHCDPLDTSLVNTKQRRSRTNFTLDQLNELERLFEETHYPDAFMREELSQRLGLSEARVQ 237

  Fly   350 VWFQNRRAKWRKHEPPRKTGYIKTS-TPPTAT-LNPGTLAP------------------PFTSYP 394
            |||||||||.||||.....|::..| :||.|| |.|..:||                  ..:|.|
  Fly   238 VWFQNRRAKCRKHENQMHKGFLVGSRSPPIATPLEPCRVAPYVSLAALRSSSVPSHPAAATSSNP 302

  Fly   395 QTTTVTPPGSMDSWTSYQTPYELTP--------QFSLLSPAASPYGTY--------SGQYGAYVH 443
            |...|:...|.....:..:|:...|        |||....||:.:..:        :.||.|.:.
  Fly   303 QAPGVSGTSSSGKVVTVDSPHNHNPAISRSAIKQFSSTVAAAAAFSAFDPAIISVAAHQYAAAIT 367

  Fly   444 E----SQLFPMRHY 453
            .    :.||.:..|
  Fly   368 NGTVPAGLFSVPQY 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 32/46 (70%)
CG34367NP_001097140.1 Homeobox 195..248 CDD:278475 36/52 (69%)
OAR 392..409 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.