DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and alx1

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001038539.1 Gene:alx1 / 565176 ZFINID:ZDB-GENE-050419-191 Length:320 Species:Danio rerio


Alignment Length:196 Identity:71/196 - (36%)
Similarity:97/196 - (49%) Gaps:47/196 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 APAA----KKDGSSSKKKGDPN--GIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKL 341
            :||.    |.|.....:|.|.|  ..||::.|||||:.||||||:.|::..||||:.||:||::.
Zfish    93 SPATSGPDKTDLDELGEKCDSNVSSSKKRRHRTTFTSAQLEELEKVFQKTHYPDVYVREQLAMRT 157

  Fly   342 NLSESRVQVWFQNRRAKWRKHEPPRKTGYIKTSTPPTATLNPGTLAPPFTSYPQ----------- 395
            .|:|:|||||||||||||||.|   :.|.|:.:....|.....::.|...||.|           
Zfish   158 ELTEARVQVWFQNRRAKWRKRE---RYGQIQQAKSHFAATYDISMLPRTDSYSQISNNLWTGPSA 219

  Fly   396 -----TTTVTPPGSMDSWTSYQTPYELTPQFSLLSPAASPYGTYSGQYGAYV----HESQLFPMR 451
                 ::.:.|.||....||   ||   |.    ||.|:.:|        ||    |:...|.:.
Zfish   220 GSSVVSSCMIPRGSPPCVTS---PY---PH----SPRAAEHG--------YVGFPNHQQNQFGVN 266

  Fly   452 H 452
            |
Zfish   267 H 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 29/46 (63%)
alx1NP_001038539.1 Homeobox 123..176 CDD:278475 34/52 (65%)
Transactivation domain. /evidence=ECO:0000250|UniProtKB:Q63087 180..320 24/106 (23%)
OAR 296..313 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 300..313
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.