DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and pdlim3b

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_005157291.1 Gene:pdlim3b / 561865 ZFINID:ZDB-GENE-060130-104 Length:332 Species:Danio rerio


Alignment Length:119 Identity:25/119 - (21%)
Similarity:46/119 - (38%) Gaps:17/119 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 GSSSKKKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIK--LNLSESRVQVWF 352
            |:.::..|.|:.....:..:....|..:.:....::|....|..:...:.|  .::.:|.|....
Zfish   142 GNVAQMAGTPSTAHSVQYNSPVALYSADNVSNTLQQAQMSTVVRQASPSSKPLTSIEDSHVYRML 206

  Fly   353 QNRRAKWRKHEPPRKTGYIKT--------STPPTATLNPGTLAPPFTSYPQTTT 398
            |:  |..:.|| ||::|..|.        .|.|..|   .::..|.|. ||..|
Zfish   207 QD--ANEQPHE-PRQSGSFKALQDYVESDGTRPMVT---RSVKAPVTK-PQAAT 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 8/48 (17%)
pdlim3bXP_005157291.1 PDZ_signaling 2..81 CDD:238492
DUF4749 156..232 CDD:292558 14/78 (18%)
LIM_ALP 262..314 CDD:188834
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.