DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and drgx

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001032182.1 Gene:drgx / 560399 ZFINID:ZDB-GENE-070330-1 Length:287 Species:Danio rerio


Alignment Length:283 Identity:87/283 - (30%)
Similarity:118/283 - (41%) Gaps:82/283 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 DGSSSKKKGD-PNGI---KKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQ 349
            :|..:...|| .:|.   |:::.|||||..|||.||..|.:..|||||||||||:|:||:|:|||
Zfish    23 NGFGNHASGDFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFAREELAMKINLTEARVQ 87

  Fly   350 VWFQNRRAKWRKHEPPRKTG-------YIKTSTPPTATLNP-----------------------G 384
            ||||||||||||.|  |.|.       .:....||...||.                       |
Zfish    88 VWFQNRRAKWRKTE--RGTSEQDGGKEQMNEGNPPARNLNQSPVDHSRSKKEPMELQQNINRVVG 150

  Fly   385 TLAPPFTSYPQTTTVTPPGSMDSWTSYQTPYELTPQFSLL--SPAAS-------------PYGTY 434
            :..|.|.|       ..||::.:..:|.   :...|.:.|  ||..|             |||..
Zfish   151 SGGPFFPS-------CLPGTLLNTATYA---QALSQVATLKGSPLCSCCVPDPMGLSFLPPYGCQ 205

  Fly   435 SGQYGAYVHESQLFPMRHYE--YGSPTRMEMGATTGSVAG--------NGDESVANGGSYQTAEL 489
            |.: .|.|...::....|.|  ..|...:..|:|||..||        .|.:|..|..:.:...|
Zfish   206 SNR-TASVAALRMKAREHSEAVLQSANLLGTGSTTGPAAGPALPLSQNTGGDSSPNSSTPKITSL 269

  Fly   490 QTAQQQQLADGTLVTVHAHQQQQ 512
            :....:          |.|.|::
Zfish   270 RRTPDK----------HLHCQKE 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 33/46 (72%)
drgxNP_001032182.1 Homeobox 46..98 CDD:278475 38/51 (75%)
OAR 207..223 CDD:281777 2/16 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.