DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and lhx8

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_012816489.1 Gene:lhx8 / 548653 XenbaseID:XB-GENE-494997 Length:385 Species:Xenopus tropicalis


Alignment Length:190 Identity:53/190 - (27%)
Similarity:77/190 - (40%) Gaps:47/190 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 VGIQGAAGTAGGVAAPAAKKDGSSSKKKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFA 333
            |.::||..|...:..|.                 ..|:.||:|||.||:.::..|.:...||...
 Frog   236 VSVEGALLTEQDINQPK-----------------PAKRARTSFTADQLQVMQAQFAQDNNPDAQT 283

  Fly   334 REELAIKLNLSESRVQVWFQNRRAKWRKHEPPRKTGYIKTSTPPTATLNPGTLAPP------FTS 392
            .::|:.:..||...:||||||.||:.:||..|.     .:||.|..|:.|..|:||      :::
 Frog   284 LQKLSERTGLSRRVIQVWFQNCRARHKKHVSPN-----HSSTTPVTTVQPSRLSPPMLEEMTYSA 343

  Fly   393 YPQTTTVTPPGSMDSWTSYQTPYELTPQFSLLSPAASPYGTYSGQYGAYVHESQLFPMRH 452
            |     |...|.|           ||...|.:. |.||  |..|......|.....|:.|
 Frog   344 Y-----VPQDGPM-----------LTALHSYMD-AHSP--TALGLQSLLPHSMTQLPISH 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 17/46 (37%)
lhx8XP_012816489.1 LIM1_Lhx7_Lhx8 103..158 CDD:188767
LIM2_Lhx7_Lhx8 165..219 CDD:188769
Homeobox 258..311 CDD:365835 21/52 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.