DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and phox2bb

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001014818.1 Gene:phox2bb / 544654 ZFINID:ZDB-GENE-050407-3 Length:284 Species:Danio rerio


Alignment Length:242 Identity:76/242 - (31%)
Similarity:97/242 - (40%) Gaps:65/242 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 SSSSAGVGIQ------------GAAGTAGGVAAPAAKKDGSSS-------KKKGDPNGI----KK 304
            ||.|...|.|            |......|..:....:|..||       |...|..|:    |:
Zfish    34 SSCSQASGFQYNPIRTTFGATSGCPSLTPGSCSLGTLRDHQSSPYAAVPYKLFTDHGGLNEKRKQ 98

  Fly   305 KKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKHE------ 363
            ::.|||||:.||:||||.|....|||::.|||||:|::|:|:||||||||||||:||.|      
Zfish    99 RRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAAAAA 163

  Fly   364 -PPRKTGYIKTS------------TPPTATLNPGTLAPPFTSY--PQTT---------------- 397
             ...|.|..|.|            |.|.:|..||....|.::.  |..|                
Zfish   164 AAAAKNGTGKKSDSREEDSKEAKATDPDSTGGPGPNPNPTSNCGGPSPTGGQVSATGNGPVEQVK 228

  Fly   398 ----TVTPPGSMDSWTSYQTPYELTPQFSLLSPAASPYGTYSGQYGA 440
                .:.|......|.|........|. ||..|.||...:...|.||
Zfish   229 TSVAGMGPTAPTQGWASAPGTITSIPD-SLGGPFASVLSSLQRQNGA 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 30/46 (65%)
phox2bbNP_001014818.1 Homeobox 102..154 CDD:278475 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.