DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and PITX3

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_005020.1 Gene:PITX3 / 5309 HGNCID:9006 Length:302 Species:Homo sapiens


Alignment Length:234 Identity:70/234 - (29%)
Similarity:100/234 - (42%) Gaps:45/234 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 GKLKKPDEMCSQLEAGGAGVTPPSSSSTVVNGTTNGTGNANSSSSAGVGIQGAAGTAGGVAAPAA 286
            |.|.:.:.....|....||...|........|..:......|:|..|                .:
Human     4 GLLSEAEARSPALSLSDAGTPHPQLPEHGCKGQEHSDSEKASASLPG----------------GS 52

  Fly   287 KKDGSSSKKKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVW 351
            .:|||..|        |:::.||.||:.||:|||..|:|..|||:..|||:|:..||:|:||:||
Human    53 PEDGSLKK--------KQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVW 109

  Fly   352 FQNRRAKWRKHEPPRKTGYIKTS--------TPPTATLNPG---------TLAPPFT--SYPQTT 397
            |:||||||||.|..::....|.|        .||...:.||         .||||..  ::|...
Human   110 FKNRRAKWRKRERSQQAELCKGSFAAPLGGLVPPYEEVYPGYSYGNWPPKALAPPLAAKTFPFAF 174

  Fly   398 TVTPPGSMDSWTSYQTPYELTPQFSLLSPAASPYGTYSG 436
            .....|.:.|...:..|..:..  |::..||:..||..|
Human   175 NSVNVGPLASQPVFSPPSSIAA--SMVPSAAAAPGTVPG 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 27/46 (59%)
PITX3NP_005020.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71 18/90 (20%)
Homeobox 66..119 CDD:395001 32/52 (62%)
OAR 258..275 CDD:397759
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 262..275
Nuclear localization signal. /evidence=ECO:0000255 268..272
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.