DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and PAX6

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001355839.1 Gene:PAX6 / 5080 HGNCID:8620 Length:503 Species:Homo sapiens


Alignment Length:303 Identity:88/303 - (29%)
Similarity:126/303 - (41%) Gaps:80/303 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 GSDGLLQDSSPVMING--GSAGGKL----------KKPDEMCSQLEAGGAGVTPPSSSSTVVNGT 254
            |:||:.....  |:||  ||.|.:.          :...:.|.|.|.||.               
Human   219 GADGMYDKLR--MLNGQTGSWGTRPGWYPGTSVPGQPTQDGCQQQEGGGE--------------- 266

  Fly   255 TNGTGNANSSSSAGVGIQGAAGTAGGVAAPAAKKDGSSSKKKGDPNGIKKK--KTRTTFTAYQLE 317
                 |.||.||.|                   :|...::.:..   :|:|  :.||:||..|:|
Human   267 -----NTNSISSNG-------------------EDSDEAQMRLQ---LKRKLQRNRTSFTQEQIE 304

  Fly   318 ELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKHEPPRKTGYIKTSTPPTATLN 382
            .||:.|||..||||||||.||.|::|.|:|:||||.|||||||:.|..|......::||....::
Human   305 ALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQASNTPSHIPIS 369

  Fly   383 PGTLAPPFTSYPQTTTVTPPGSMDSWTSY-QTPYELTPQFSLLSPAAS-----------PYGTYS 435
            .......:...||.|  ||..|..|.:.. :|...||..:|.|.|..|           |..:.:
Human   370 SSFSTSVYQPIPQPT--TPVSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQT 432

  Fly   436 GQYGAYVHESQLFPMRHYEYGSPTRME-------MGATTGSVA 471
            ..|...:..|.....|.|:..:|..|:       || |:|:.:
Human   433 SSYSCMLPTSPSVNGRSYDTYTPPHMQTHMNSQPMG-TSGTTS 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 30/46 (65%)
PAX6NP_001355839.1 PAX 85..209 CDD:128645
Homeobox 295..348 CDD:395001 35/52 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.