DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and PAX4

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001353039.1 Gene:PAX4 / 5078 HGNCID:8618 Length:351 Species:Homo sapiens


Alignment Length:241 Identity:63/241 - (26%)
Similarity:91/241 - (37%) Gaps:64/241 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 SDGL-LQDSSPVMINGGSAGGKLKKPDEM-CSQLEAGGA---GVTPPSSSSTVVNGTTNGTGNAN 262
            ::|| .||.:|.:.:.......|::...: |::|.:...   .|..|.|.|....||..|||:.|
Human   109 AEGLCTQDKTPSVSSINRVLRALQEDQGLPCTRLRSPAVLAPAVLTPHSGSETPRGTHPGTGHRN 173

  Fly   263 SSSSAGVGIQGAAGTAGGVAAPAAKKDGSSSKKKGDPNGIKKKKTRTTFTAYQLEELERAFERAP 327
                                                         ||.|:..|.|.||:.|:|..
Human   174 ---------------------------------------------RTIFSPSQAEALEKEFQRGQ 193

  Fly   328 YPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKHE--------PPRKTGYIKTSTPP---TATL 381
            |||..||.:||...:|.|..|:|||.|||||||:.|        |....|.......|   :|..
Human   194 YPDSVARGKLATATSLPEDTVRVWFSNRRAKWRRQEKLKWEMQLPGASQGLTVPRVAPGIISAQQ 258

  Fly   382 NPGTLAPPFTSYPQTTTVTPPGSMDSW-TSYQTPYELTPQFSLLSP 426
            :||::  |..:.|....:.|......| |:.:.....||..:.|.|
Human   259 SPGSV--PTAALPALEPLGPSCYQLCWATAPERCLSDTPPKACLKP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 24/46 (52%)
PAX4NP_001353039.1 PAX 5..129 CDD:128645 5/19 (26%)
Homeobox 174..226 CDD:306543 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.