DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and Rhox10

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001020021.1 Gene:Rhox10 / 434769 MGIID:3580249 Length:196 Species:Mus musculus


Alignment Length:117 Identity:31/117 - (26%)
Similarity:58/117 - (49%) Gaps:9/117 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 KKDGSSSKKKGD--PNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQ 349
            :|:..:..|:.:  ...:.::.....:|..|:.|||:||:...|||...|:.||..:::.|.:|:
Mouse    68 RKETQARPKEPEKAAGAVSRRSNSKKYTNAQMCELEKAFQETQYPDAHQRKALAKLIDVDECKVK 132

  Fly   350 VWFQNRRAKWRKHEPPRKTGYIKTSTPPTATLNPGTLAPPFTSYPQTTTVTP 401
            .||:.:|||:|     ||...:..|...:.|.|  ..:......|:::|..|
Mouse   133 AWFKYKRAKYR-----RKQKELLLSNATSGTSN--NFSAQMNEDPKSSTSVP 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 19/46 (41%)
Rhox10NP_001020021.1 Homeobox 94..143 CDD:278475 20/48 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.