DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and Rhox10

DIOPT Version :10

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001020021.1 Gene:Rhox10 / 434769 MGIID:3580249 Length:196 Species:Mus musculus


Alignment Length:117 Identity:31/117 - (26%)
Similarity:58/117 - (49%) Gaps:9/117 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 KKDGSSSKKKGD--PNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQ 349
            :|:..:..|:.:  ...:.::.....:|..|:.|||:||:...|||...|:.||..:::.|.:|:
Mouse    68 RKETQARPKEPEKAAGAVSRRSNSKKYTNAQMCELEKAFQETQYPDAHQRKALAKLIDVDECKVK 132

  Fly   350 VWFQNRRAKWRKHEPPRKTGYIKTSTPPTATLNPGTLAPPFTSYPQTTTVTP 401
            .||:.:|||:|     ||...:..|...:.|.|  ..:......|:::|..|
Mouse   133 AWFKYKRAKYR-----RKQKELLLSNATSGTSN--NFSAQMNEDPKSSTSVP 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeodomain 313..361 CDD:459649 19/47 (40%)
Rhox10NP_001020021.1 Homeodomain 94..144 CDD:459649 21/54 (39%)

Return to query results.
Submit another query.