DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and Rhox8

DIOPT Version :10

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001004193.1 Gene:Rhox8 / 434768 MGIID:3579898 Length:320 Species:Mus musculus


Alignment Length:163 Identity:53/163 - (32%)
Similarity:78/163 - (47%) Gaps:34/163 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 GGSAGGKLKKPDEMCSQLE---------------AGGAGVTPPSSSSTVVNGTTNGTGNANSSSS 266
            ||...|:.::.:|...:.|               |..|.....:.||..|:..::..|.:::...
Mouse   171 GGEGEGEEEEEEEEEEEEEEEEEEEEEEEEEAAAAAAARDETTAGSSAPVDDRSHDAGASSNGED 235

  Fly   267 AGVG---IQGAAGTAGGVAAPAAKKDGSSSKKKGDPNGIKKKKTRTTFTAYQLEELERAFERAPY 328
            .|.|   |.|  ||.|..|.|:             |:| :..:.|..||.:||:||||.|||..|
Mouse   236 RGQGEELIPG--GTKGLEALPS-------------PSG-QLPRNRYRFTKFQLQELERIFERNHY 284

  Fly   329 PDVFAREELAIKLNLSESRVQVWFQNRRAKWRK 361
            |...||.|||..:.::||||:.||::||||:||
Mouse   285 PSAAARRELARWIGVTESRVENWFKSRRAKYRK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeodomain 313..361 CDD:459649 26/47 (55%)
Rhox8NP_001004193.1 Homeodomain 262..317 CDD:459649 29/54 (54%)

Return to query results.
Submit another query.