DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and si:dkey-43p13.5

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_002661267.2 Gene:si:dkey-43p13.5 / 407678 ZFINID:ZDB-GENE-131121-510 Length:315 Species:Danio rerio


Alignment Length:182 Identity:55/182 - (30%)
Similarity:88/182 - (48%) Gaps:23/182 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 AAKKDGSSSKKKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQ 349
            |....|..:....:|..:|:::.|..::::||||||:.|:...|||:|.||.||::|:|.|:|||
Zfish   122 AHPSSGHPADNIDEPRPVKQRRARANYSSWQLEELEKTFQSTHYPDIFMREALALRLDLIEARVQ 186

  Fly   350 VWFQNRRAKWRKH-EPPRKTGY------IKTSTPPTATLNP----GTLAP----------PFTSY 393
            |||||||||.|:. :...:||.      ..|..|.::..||    .:.:|          |....
Zfish   187 VWFQNRRAKMRRQLKLQIQTGEQCSQRDTDTRHPESSISNPELHNNSPSPCWDRNQDRTNPAHPK 251

  Fly   394 PQTTTVTPPGSMDSWTSYQTPYELTPQFSLLSPAASPYGTYSGQYGAYVHES 445
            |..:.:..|.: |.....|.|....|: .|.|.:.:.....:..|.|.:|.:
Zfish   252 PSPSAIQSPVT-DLLQDQQDPEAPGPE-DLRSCSIAKLRAKARDYEAEIHST 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 30/46 (65%)
si:dkey-43p13.5XP_002661267.2 Homeobox 145..197 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580714
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.