DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and PHOX2A

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_005160.2 Gene:PHOX2A / 401 HGNCID:691 Length:284 Species:Homo sapiens


Alignment Length:288 Identity:81/288 - (28%)
Similarity:108/288 - (37%) Gaps:109/288 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 SAGVGIQGAAGTAGG-----------VAAPAAKKDGSSSKKKG-------------------DPN 300
            ::..|..||....||           .|.|.....|||:...|                   :|:
Human    18 ASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPYKFFPEPS 82

  Fly   301 GI----KKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRK 361
            |:    |:::.|||||:.||:||||.|....|||::.|||||:|::|:|:||||||||||||:||
Human    83 GLHEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRK 147

  Fly   362 HE-----------PPRKTGYIKTSTPPTATLNPGTLAPPFTSYPQTTTVTPPGSMDSWTSYQTPY 415
            .|           ...|.|..:.|:....: ...|.:|.    |.:|...||             
Human   148 QERAASAKGAAGAAGAKKGEARCSSEDDDS-KESTCSPT----PDSTASLPP------------- 194

  Fly   416 ELTPQFSLLSPAASPYGTYSGQYGAYVHESQLFPMRHYEYGSPTRMEMGATTG------------ 468
              .|...|.||..||                          ||..:.:|:..|            
Human   195 --PPAPGLASPRLSP--------------------------SPLPVALGSGPGPGPGPQPLKGAL 231

  Fly   469 --SVAGNGDESVANGGSYQTAELQTAQQ 494
              .|||.|    ..|.....|||..|.|
Human   232 WAGVAGGG----GGGPGAGAAELLKAWQ 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 30/46 (65%)
PHOX2ANP_005160.2 Homeobox 94..147 CDD:365835 35/52 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..284 32/161 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.