DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and eyg

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001014582.1 Gene:eyg / 39419 FlyBaseID:FBgn0000625 Length:670 Species:Drosophila melanogaster


Alignment Length:428 Identity:116/428 - (27%)
Similarity:160/428 - (37%) Gaps:121/428 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 GGAGVTPPSSSSTVVNGTTNGTGNANSSSSAGVGIQGA---------AGTAGGVAAPAAKKDGSS 292
            ||.||.||...|.:.:.......|...|:::.|.:...         ||.|||.....|...||.
  Fly   257 GGQGVPPPPPPSALWSVAAPTLANLPPSAASAVPVSTCGSLSSAHLMAGGAGGTPTNRAISPGSG 321

  Fly   293 SKKK---------------GDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLN 342
            |...               .|.:..|.::.||||:..||||||:.|:::.||.|..||.|:.:.:
  Fly   322 SHDTLESADENRHIDSDYLDDDDEPKFRRNRTTFSPEQLEELEKEFDKSHYPCVSTRERLSSRTS 386

  Fly   343 LSESRVQVWFQNRRAKWRKHE-----------PPRKTGYIKTSTPPTATLNPGTLAPPFTSYPQT 396
            |||:||||||.|||||||:|:           |.......:::..|.::..|...:...||.| .
  Fly   387 LSEARVQVWFSNRRAKWRRHQRMNLLKRQRSSPANPLHSQQSNDAPASSPTPSNHSSASTSAP-V 450

  Fly   397 TTVTPPGSMDSWTSYQTPYEL--------TPQFSLLSPAASPYGTYSGQYGAYV--HESQLFPMR 451
            ..|.||         |.|..|        .|...||.|...|.|.:...:..::  |.:.|..:.
  Fly   451 APVPPP---------QQPLPLCGDHSPQGPPPSVLLHPLHGPPGGHHHHHPLHLPTHPAALQLLS 506

  Fly   452 HYEYGSPTRMEMGATTGSVAGNGDESVANGGSYQTAELQTAQQQQLADGTLVTVHAHQQQQ--QQ 514
            ||.                                .:.|..||||         |..||||  ||
  Fly   507 HYH--------------------------------QQQQQQQQQQ---------HQQQQQQHHQQ 530

  Fly   515 QQQL---------NGKYLSAEEAKYVHLQCHQSGG---GLELSPGASCHLVEAQGQ----HYVTT 563
            ||||         |...:..|.:.:..|....|..   ||......:..|..|:.|    ||   
  Fly   531 QQQLSPSGCNPAANHLSMGGERSAFRSLVSSPSAAAFLGLARQYAVAASLTVAEEQRSRLHY--- 592

  Fly   564 ATGGAASAG---GTSSDDNDSGG-MQTVIKSEEVSQQQ 597
            :.||..|.|   |.:::...||| ..||..|...|.::
  Fly   593 SAGGLGSGGEGTGPNTNTTQSGGSTMTVDNSSSDSDEE 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 27/46 (59%)
eygNP_001014582.1 HTH 120..217 CDD:304362
Homeobox 352..404 CDD:278475 31/51 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450824
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.