DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and Zasp66

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster


Alignment Length:423 Identity:87/423 - (20%)
Similarity:134/423 - (31%) Gaps:107/423 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 TATPP----PSHNGILLHKQSSQQQQQQ----QQQLVGILDYHPLNGKLDYSS--SPKDQYEPQQ 184
            |..||    ||.    ..::||...:::    .:|.||:....|.:|:|....  |...:|:.:.
  Fly    34 TPKPPLVPLPSP----CRRRSSSGLKKRVHFADEQNVGVQVGSPAHGELLRGDIISKIGEYDARD 94

  Fly   185 LQH-----LYGGSPH------HLDHLDHGSDGLLQDSSPVMINGGSAGGKLK--KPDEMCSQLEA 236
            |.|     |:.|:.:      |.|:....:.|..|::.|    |..:...|.  .||.|..:   
  Fly    95 LSHADAQQLFRGAGNEIRLVVHRDNKIAYTQGATQEAGP----GSRSNSTLPPVTPDLMPHR--- 152

  Fly   237 GGAGVTP----PSSSSTVVN---GTTNGTGNANSSSSAGVGIQGAAGTAGGVAAPAAKKDGSSSK 294
               |.:|    ||.....:.   .|...|.....:||.|..:...      |.:|...:|.....
  Fly   153 ---GPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGGYEVPST------VFSPKPTRDHQQDV 208

  Fly   295 KK------GDP--------NGIKKKKTRTTFTAYQLEELERAFERAP---YPDVFAREELA---- 338
            .:      ..|        .|.|.||...|..:|.......|....|   |.|...::.:|    
  Fly   209 DEEQAAIVNQPYRTTPLVLPGAKVKKDAPTTESYLRHYPNPAVRAHPGHDYHDSIMKQRVADTML 273

  Fly   339 IKLNLSESRVQVWFQNRRAKWRKHEPPRKTGYIKT--------STPPTATLNPGTLAPPFTSYPQ 395
            .|:..||:      ...|...::...|  .|....        ||.|.||.....|.......|.
  Fly   274 HKVVGSEA------DTGRVFHKQFNSP--IGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPL 330

  Fly   396 TTTVTPPGSMDSWTSYQTPYELTPQFSLLSPAASPYGTYSGQYGAYVHESQLFPMRHYEYGSPTR 460
            .|.:         ..|:...:..|:.|....|....|.|| .||....:....|::...| .|.|
  Fly   331 PTKL---------NGYKKTVQYDPRNSETYRAIQEEGGYS-NYGQSSPQEVTIPVQTKVY-QPNR 384

  Fly   461 MEMGATTGS---------VAGNGDESVANGGSY 484
            :..|....|         |....||::...||:
  Fly   385 LVPGKKPVSAPVSRPPYNVVNTHDENIRQSGSF 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 10/53 (19%)
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 9/46 (20%)
DUF4749 285..359 CDD:292558 15/84 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.