DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and gsb-n

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster


Alignment Length:366 Identity:98/366 - (26%)
Similarity:137/366 - (37%) Gaps:98/366 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 PPSSS--STVVNGTTNGTGNANSSSSAGVGIQGAAGTAGGVAAPAAKKDGSSSKKKGDPNGI--- 302
            |||:|  |.::.|:..|:.:.....:..       |..||       :|...|..:.:| ||   
  Fly   130 PPSTSSISRLLRGSDRGSEDGRKDYTIN-------GILGG-------RDSDISDTESEP-GIPLK 179

  Fly   303 -KKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKHE--- 363
             |::::||||||.|||.|||||.|..||||:.|||||....|:|:|:||||.||||:.|||.   
  Fly   180 RKQRRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRARLRKHSGGS 244

  Fly   364 ----PPRKTGYIKTS-----TPPTATLNPGTLAPPFTSYPQTTTVTPPGSMDSWTSYQTPYELTP 419
                .|..:|.....     :..||.|..|.|.              .|||..:           
  Fly   245 NSGLSPMNSGSSNVGVGVGLSGATAPLGYGPLG--------------VGSMAGY----------- 284

  Fly   420 QFSLLSPAASPYGTYSGQYGAYVHESQLFPMRHYEYGSPTRMEMGATTGSVAGNGDESVANGGSY 484
                 |||.....|.:|.... ||.:...|..|:          .|.|.:.|.:....:   |.|
  Fly   285 -----SPAPGTTATGAGMNDG-VHHAAHAPSSHH----------SAATAAAAAHHHTQM---GGY 330

  Fly   485 QTAELQTAQQQQLADGTLVTVHAHQQQQQQQQQL-----NGKYLSAEEAKYVHLQCHQSGGGLEL 544
            ..  :|:|.|.....|.....|...|....|...     :...|:|:....:....|.|....:|
  Fly   331 DL--VQSAAQHGFPGGFAQPGHFGSQNYYHQDYSKLTIDDFSKLTADSVSKISPSLHLSDNYSKL 393

  Fly   545 -------------SPGASCHLVEAQGQHYVTTAT-GGAASA 571
                         :...:.|:.:.|...|...|. |..|||
  Fly   394 EAPSNWSQAAYHAAANYNAHVAQHQLNDYAAAAAHGNPASA 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 30/46 (65%)
gsb-nNP_523862.1 PAX 20..141 CDD:278709 5/10 (50%)
Homeobox 185..238 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450989
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.