DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and lhx8a

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001003980.1 Gene:lhx8a / 378959 ZFINID:ZDB-GENE-031008-2 Length:332 Species:Danio rerio


Alignment Length:158 Identity:45/158 - (28%)
Similarity:68/158 - (43%) Gaps:27/158 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 GVGIQGAAGTAGGVAAPAAKKDGSSSKKKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVF 332
            ||.::||..:...|..|.                 ..|:.||:|||.||:.::..|.:...||..
Zfish   182 GVNVEGAVPSEQEVNQPK-----------------PAKRARTSFTADQLQVMQAQFAQDNNPDAQ 229

  Fly   333 AREELAIKLNLSESRVQVWFQNRRAKWRKHEPPRKTGYIKTSTPPTATLNPGTLAPPFTSYPQTT 397
            ..::||.:..||...:||||||.||:.:||..|.     .:|..|.::|....|:||.....|.|
Zfish   230 TLQKLAERTGLSRRVIQVWFQNCRARHKKHVSPN-----HSSAAPVSSLQSAHLSPPLIDELQYT 289

  Fly   398 TVTPPG-----SMDSWTSYQTPYELTPQ 420
            ...|..     ::.|:....:|..|..|
Zfish   290 AFAPVDTPMLTALHSYMDVHSPTSLVLQ 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 18/46 (39%)
lhx8aNP_001003980.1 LIM1_Lhx7_Lhx8 50..105 CDD:188767
LIM2_Lhx7_Lhx8 112..166 CDD:188769
Homeobox 205..257 CDD:278475 22/51 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.