DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and otx5

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_851848.2 Gene:otx5 / 353179 ZFINID:ZDB-GENE-030508-1 Length:289 Species:Danio rerio


Alignment Length:228 Identity:78/228 - (34%)
Similarity:111/228 - (48%) Gaps:43/228 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 GDPNGIKK-KKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWR 360
            |.||..:| ::.|||||..||:.||..|.:..|||:|.|||:|:|:||.||||||||:|||||.|
Zfish    30 GYPNTPRKQRRERTTFTRAQLDVLEALFSKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94

  Fly   361 KHEPPRKTGYIK---------------TSTPPTATLNPGTLAPPFTSYPQTTTVTPPGSMDSWTS 410
            :.:..:.:|..|               .|.|..:|..|.:..||    |..|.:| |.|..:..|
Zfish    95 QQQQQQTSGQTKPRPPKKKSSPARDSSASEPSASTSGPYSPPPP----PPGTAIT-PSSSSATVS 154

  Fly   411 YQTPYELTPQFSLLSPAASPYG----------TYS--GQYG-AYVHESQLFP-MRHYEYGSPTRM 461
            ..:|..::|   |..|.::|..          |||  ..|| :|...|..|. :....|.||...
Zfish   155 IWSPASISP---LPDPLSAPSTACLQRSSYPMTYSQAPAYGQSYAASSSYFTGLDCSSYLSPMHP 216

  Fly   462 EMGATTGS---VAGNGDESVANGGS--YQTAEL 489
            ::.|:.|:   ::|...:|.|:..|  |..|.|
Zfish   217 QLSASGGALSPMSGALSQSPASLSSQGYTAASL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 29/46 (63%)
otx5NP_851848.2 Homeobox 42..94 CDD:278475 34/51 (67%)
TF_Otx 157..231 CDD:281521 18/76 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.