DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and prd

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster


Alignment Length:395 Identity:117/395 - (29%)
Similarity:173/395 - (43%) Gaps:72/395 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 TPPSSS--STVVNGTTNGTGNANSSSS---AGVGIQGAAG----TAGGVAAPAAKKDGSSSKKKG 297
            |.||.|  |.:|.|......|..||:|   ||.|.:.::.    .:||........|...|..:.
  Fly   139 TAPSVSAISRLVRGRDAPLDNDMSSASGSPAGDGTKASSSCGSDVSGGHHNNGKPSDEDISDCES 203

  Fly   298 DPNGI----KKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAK 358
            :| ||    |:::.||||:|.||:||||||||..|||::.|||||.:.||:|:|:||||.||||:
  Fly   204 EP-GIALKRKQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFSNRRAR 267

  Fly   359 WRKHEPPRKTGYIKTSTPPTATLNPGTLAPPFTSYPQTTTVTP--------PGSMDSWTSYQTPY 415
            .||....     :....|..|..:...:|.. :|.|...:..|        |||:|..|.||..|
  Fly   268 LRKQHTS-----VSGGAPGGAAASVSHVAAS-SSLPSVVSSVPSMAPLAMMPGSLDPATVYQQQY 326

  Fly   416 ELTPQFSLLS-PAASPYGTYSGQYGAYVHESQLFPMRHYEYGSPTRMEMGATTGSVAGNGDESVA 479
            :.....:.:| .||:|..:.:...|.     ...|..|:::.:|:     |.|.|....|:    
  Fly   327 DFYGSHANISVSAAAPMASSNLSPGI-----TTTPPHHHQFYNPS-----ANTASYIMPGE---- 377

  Fly   480 NGGSYQTAE-LQTAQQQQLAD--GTLVTVHAHQQQQQQQQQLNGKYLSAEEAKYVHLQCHQSGGG 541
            ||.:..|.. :.::.:.||..  ||....|   |...:.:..|....||             .|.
  Fly   378 NGNTTPTGNIIVSSYETQLGSVYGTETETH---QTMPRNESPNESVSSA-------------FGQ 426

  Fly   542 LELSPGASCHLVEAQGQHYVTTATGGAASAGGTSSDDNDSGG---MQTVIKSEEV----SQQQQQ 599
            |..:|.:...:|...|   ||:::|..:.|..:.|..|.|.|   :...:|.|.|    :.|.|.
  Fly   427 LPPTPNSLSAVVSGAG---VTSSSGANSGADPSQSLANASAGSEELSAALKVESVDLIAASQSQL 488

  Fly   600 QQGQS 604
            ..|.|
  Fly   489 YGGWS 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 31/46 (67%)
prdNP_723721.1 PAX 27..154 CDD:238076 7/14 (50%)
Homeobox 217..269 CDD:278475 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450990
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.