DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and Gsc

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster


Alignment Length:486 Identity:117/486 - (24%)
Similarity:165/486 - (33%) Gaps:196/486 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PNGGGGGAGSGGAGGSPNYVTKLDFVNKMGCYSPSQ---KYEYISAPQKLVEQQQQQQHHHQHHQ 127
            |.|||||..:.....:|:             ..||:   |...:|.|.                .
  Fly     8 PGGGGGGTTTTTPSTTPD-------------IPPSKAKFKITVVSTPS----------------P 43

  Fly   128 HYTATPPPSHN-------------GILLHKQSSQ--QQQQQQQQLV----GILDYHPLNGKLDYS 173
            ....||||:.:             |..|.:..|.  :|||..:|:.    ....||.....|  .
  Fly    44 SPPPTPPPAGSMLAQMVETNSPPAGYTLKRSPSDLGEQQQPPRQISRSPGNTAAYHLTTAML--L 106

  Fly   174 SSPKDQYEPQQLQHLYGGSPHHLDH---------LDHGSDG---LLQDSSPVMINGGSAGGKLKK 226
            :|.:..|..|:||.:.  ...|..|         .|.||..   :|::..    .||:|...|..
  Fly   107 NSQQCGYLGQRLQSVL--QQQHAQHQQSQSQTPSSDDGSQSGVTILEEER----RGGAAAASLFT 165

  Fly   227 PDEMCSQLEAGGAGVTPPSSSSTVVNGTTNG-------------------TGNANSSSSAG---- 268
            .|.:....:.|| |..|...|....||..||                   :.|:||||||.    
  Fly   166 IDSILGSRQQGG-GTAPSQGSHISSNGNQNGLTSNGISLGLKRSGAESPASPNSNSSSSAAASPI 229

  Fly   269 ---------------VGIQGAAGTAGGVAAPA----------------------------AKKDG 290
                           :|...||..:|..|:|:                            |...|
  Fly   230 RPQRVPAMLQHPGLHLGHLAAAAASGFAASPSDFLVAYPNFYPNYMHAAAVAHVAAAQMQAHVSG 294

  Fly   291 SSSKKKG------DPNG--------------------------IKKKKTRTTFTAYQLEELERAF 323
            :::...|      .|:|                          .:|::.||.||..|||:||..|
  Fly   295 AAAGLSGHGHHPHHPHGHPHHPHLGAHHHGQHHLSHLGHGPPPKRKRRHRTIFTEEQLEQLEATF 359

  Fly   324 ERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRK-----HEPPRK----------TGYIKT 373
            ::..||||..||:||:|::|.|.||:|||:||||||||     .|..||          .|...:
  Fly   360 DKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKREEQERLRKLQEEQCGSTTNGTTNS 424

  Fly   374 STPPTATLNPGTLAPPFTSYPQTTTVTPPGS 404
            |:..|::...|:|           ||..|||
  Fly   425 SSGTTSSTGNGSL-----------TVKCPGS 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 27/46 (59%)
GscNP_001137762.2 Homeobox 343..396 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451025
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.