DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and Pph13

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster


Alignment Length:302 Identity:92/302 - (30%)
Similarity:121/302 - (40%) Gaps:112/302 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 KKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKHEPPRK 367
            |:::.||||...||:||||||:|..|||||.|||||::::|:|:|||||||||||||||.|   |
  Fly     9 KQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQE---K 70

  Fly   368 TG-----Y------IKTSTPPTATLNP--------GTLAPPFTSYPQTTTVTPPGSMDSW----- 408
            .|     |      :..|...:|.|..        |||.|.          |||.|.:|.     
  Fly    71 IGGLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPD----------TPPQSSNSLDNELK 125

  Fly   409 TSYQT----PYELTPQFSLL------------SPAASPYGTYSGQYGAYVHESQLFPMRHYEYGS 457
            .||.|    |..|:|...|.            |..:..:.||..|..|..|.         :..|
  Fly   126 ASYGTGAMSPSRLSPNIFLNLNIDHLGLERGGSGLSMEWSTYPPQTQAQTHP---------QMDS 181

  Fly   458 PTRMEMGATTGSVAGNGDESVANGGSYQTAELQTAQQQQLADGTLVTVHA-----HQQQQQQQQQ 517
            ..:::                           |...||..:|    .:||     |||||||.||
  Fly   182 DNQLQ---------------------------QHPPQQHASD----PIHAGSSSHHQQQQQQHQQ 215

  Fly   518 LNGKYLSAEEAKYVHLQCHQSGGGLELSPGASCHLVEAQGQH 559
                       :..:.|.|.   |||.:...|..:.:....:
  Fly   216 -----------EQHNPQLHP---GLEFAASLSLDMTDGSSAY 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 33/46 (72%)
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 37/51 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451006
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.