DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and al

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster


Alignment Length:427 Identity:124/427 - (29%)
Similarity:168/427 - (39%) Gaps:121/427 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 KLKKPDEMCSQLEAGGAGVTPPSSSSTVVNGTTNGTGNANSSSSAGVGIQGAAGTAGGVAAPAAK 287
            ||..||.:.....|.|:......::.||            |.|.:|....||:|.:||..:|.: 
  Fly    17 KLAHPDAVVLVDRAPGSSAASAGAALTV------------SMSVSGGAPSGASGASGGTNSPVS- 68

  Fly   288 KDGSSSKKKGD--PNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQV 350
             ||:|..:..:  |.. |:::.|||||::||||||:||.|..|||||.|||||:|:.|:|:|:||
  Fly    69 -DGNSDCEADEYAPKR-KQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQV 131

  Fly   351 WFQNRRAKWRKHEP--PRKTGY--------------IKTSTPPTATLNPGT-----LAPPFTS-- 392
            |||||||||||.|.  |:...|              :..:.||    ||.|     |..||.:  
  Fly   132 WFQNRRAKWRKQEKVGPQSHPYNPYLPGGAATMQTVVGAALPP----NPFTHLGFQLRKPFDAQH 192

  Fly   393 --------YPQTTT--VTPPGSMDSWTSYQTPYELTPQFSLLSPAASPYGTYSGQYG-AYVHESQ 446
                    ||..:.  :.|.|..:             ||....|...|:| .:|.|. :...:|.
  Fly   193 AANLAAFRYPHLSAAPMIPSGYFN-------------QFQRAPPHMLPHG-MAGMYSPSSSFQSL 243

  Fly   447 LFPMRHYEYGSPTRMEMGATTGSVAGNGDESVANGGSYQTAELQTAQQQQLADGTLVTVHAHQQQ 511
            |..|.....|:|    :|.....:.|:.|....|              ..||.........|..|
  Fly   244 LANMTAVPRGTP----LGKPPALLVGSPDLHSPN--------------HMLASPPTSPASGHASQ 290

  Fly   512 QQQQQQLNGKYLSAEEAKYVHLQCHQSGGGLELSPGASCHLVEAQGQHYVTTA-TGGAASAGGTS 575
            .||....:.....|.....|.:|..|      |||           ||.|..| |..|:|...| 
  Fly   291 HQQHPTAHPPPPQAPPQMPVGVQPAQ------LSP-----------QHLVGIALTQQASSLSPT- 337

  Fly   576 SDDNDSGGMQTVIKSEEVSQQQQQQQGQSYVLPPFLH 612
                     ||...:..:|...|:|      |||..|
  Fly   338 ---------QTSPVALTLSHSPQRQ------LPPPSH 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 33/46 (72%)
alNP_722629.1 Homeobox 89..141 CDD:278475 38/51 (75%)
OAR 374..391 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451007
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.