DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and CG11294

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001259352.1 Gene:CG11294 / 31807 FlyBaseID:FBgn0030058 Length:261 Species:Drosophila melanogaster


Alignment Length:324 Identity:90/324 - (27%)
Similarity:129/324 - (39%) Gaps:123/324 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 KKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKHEPPRK 367
            ::::.|||||..||:|||..|::..|||||.|||:|::::|||:|||||||||||||||.     
  Fly    23 RQRRNRTTFTPQQLQELEALFQKTHYPDVFLREEVALRISLSEARVQVWFQNRRAKWRKQ----- 82

  Fly   368 TGYIKTSTPPTATLNPGTLAPPFTSYPQTTTVTPPGSMDSWTSYQTPYELTPQFSLLSPAASPYG 432
                                                               .:..||..|     
  Fly    83 ---------------------------------------------------ARLQLLQDA----- 91

  Fly   433 TYSGQYGAYVHESQLFPMRHYEYGSPTRMEMGATTGSVAGNGDESVANGGSYQTAELQTA-QQQQ 496
                           :.||....|:|..|..||..|   |:|:.:.|...|.....|.:| :..:
  Fly    92 ---------------WRMRCLSLGTPPVMGGGAVQG---GSGNGATARPPSQTPENLSSASKDSE 138

  Fly   497 LAD-------GTLVTVHAHQQQQQQQQQLNGKYLSAEEAK----YVHLQCHQS-GGGLELSPGAS 549
            ||:       |:...:|...|||.||||..|...:.::.|    |..|:.::: ..|:||     
  Fly   139 LAEVGNGPNSGSFTMMHPAFQQQHQQQQHQGHQQATDQDKLSKTYTELKLYKAPSHGMEL----- 198

  Fly   550 CHLVEAQGQHYVTTATGGAASAGGTSSDDND----------SGGMQTVIKSEEVSQQQQQQQGQ 603
                            ||.|:..|.|.:.:|          ||......:|.::.|||||||.|
  Fly   199 ----------------GGMAALSGHSDEGSDGSDSEEIDLTSGACIDFSQSSKLQQQQQQQQQQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 30/46 (65%)
CG11294NP_001259352.1 Homeobox 29..80 CDD:278475 34/50 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451008
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.