DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and Gsc

DIOPT Version :10

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001178802.1 Gene:Gsc / 317715 RGDID:631425 Length:256 Species:Rattus norvegicus


Alignment Length:61 Identity:33/61 - (54%)
Similarity:45/61 - (73%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 KKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKHE 363
            :|::.||.||..|||.||..|:...||||..||:||.|::|.|.:|:|||:|||||||:.:
  Rat   159 RKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeodomain 313..361 CDD:459649 27/47 (57%)
GscNP_001178802.1 Homeodomain 161..217 CDD:459649 31/55 (56%)

Return to query results.
Submit another query.