DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and Dux4

DIOPT Version :10

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001419931.1 Gene:Dux4 / 306226 RGDID:1311053 Length:357 Species:Rattus norvegicus


Alignment Length:149 Identity:51/149 - (34%)
Similarity:80/149 - (53%) Gaps:21/149 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 SKKKG-DPNGIKKK-KTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNR 355
            |:::| |...:|:. ::||.||.:|::.|..|||:..:|.:..||:||.:..:.|||:.:|||||
  Rat    81 SQEQGQDKPRVKEAGRSRTHFTKFQIDILIEAFEKNRFPGIVTREKLAQETGIPESRIHIWFQNR 145

  Fly   356 RAKWRKHEPPRKTGYIKTSTPPTATLNP-----GTLAP---PFTS----YPQTTTVTPPGSMDSW 408
            ||:    .|..|.|...||.||.::..|     |.|||   |.:|    .|.:...||.|.:|..
  Rat   146 RAR----HPDPKQGTRATSHPPESSQCPAQKTTGQLAPSKDPTSSCSVILPLSPPHTPNGPLDLS 206

  Fly   409 TSYQTPYELTPQFSLLSPA 427
            ...|   :..|:.::|.|:
  Rat   207 RGRQ---KQLPETTVLQPS 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeodomain 313..361 CDD:459649 20/47 (43%)
Dux4NP_001419931.1 homeodomain 15..71 CDD:238039
Homeodomain 96..149 CDD:459649 24/56 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.