DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and vsx1

DIOPT Version :10

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_571408.1 Gene:vsx1 / 30598 ZFINID:ZDB-GENE-990415-205 Length:344 Species:Danio rerio


Alignment Length:75 Identity:45/75 - (60%)
Similarity:55/75 - (73%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 DGSSSKKKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQ 353
            |.:..|..|:....||::.||.||::||||||:||..|.||||:|||.||:|..|.|.|:|||||
Zfish   136 DRNDGKNSGNSQKRKKRRHRTVFTSHQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQ 200

  Fly   354 NRRAKWRKHE 363
            ||||||||.|
Zfish   201 NRRAKWRKRE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeodomain 313..361 CDD:459649 33/47 (70%)
vsx1NP_571408.1 Octapeptide motif 37..44
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..70
COG5576 101..>221 CDD:227863 45/75 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..156 5/19 (26%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:11331779 147..151 0/3 (0%)
Homeodomain 152..208 CDD:459649 37/55 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..344
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.