DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and rx3

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_571302.1 Gene:rx3 / 30474 ZFINID:ZDB-GENE-990415-238 Length:292 Species:Danio rerio


Alignment Length:279 Identity:88/279 - (31%)
Similarity:120/279 - (43%) Gaps:70/279 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 QLVGILDYHPLNGKLDYSS----SPKDQYEPQQLQHLYGGSPHHLDH--LDHGSDGLLQDSSPVM 214
            :||| ..|..:..:|..|:    ||..|.....::.:.|.....|.|  ..:||           
Zfish     2 RLVG-SQYKDMEDRLSPSARLVRSPGSQTRIHSIESILGFKGETLFHPAFPYGS----------- 54

  Fly   215 INGGSAGGKLKKPDEMCSQLEAGGAGVTPPSSSSTVVNGTTNGTGNANSSSSAGVGIQGAAGTAG 279
                   ||..|..|..|          |...|:...:|....|                     
Zfish    55 -------GKTGKDTEHLS----------PKKDSNKHFDGVCRST--------------------- 81

  Fly   280 GVAAPAAKKDGSSSKKKGDPNGIKK-KKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNL 343
             |.......|....|...|.|..|| ::.|||||.:||.|||||||::.||||::|||||:|:||
Zfish    82 -VMVSPDLPDADGGKLSDDENPKKKHRRNRTTFTTFQLHELERAFEKSHYPDVYSREELALKVNL 145

  Fly   344 SESRVQVWFQNRRAKWRKHEPPRKTGYIK------TSTPPTATLNPGTLAP--PFTSYPQTTTVT 400
            .|.||||||||||||||:.| ..:...||      .|.|.:..|:.|:..|  |:.:.|.:|:.:
Zfish   146 PEVRVQVWFQNRRAKWRRQE-KLEVSSIKLQESSMLSIPRSGPLSLGSGLPLEPWLTGPISTSSS 209

  Fly   401 PPGSMDSWTSYQTPYELTP 419
            |   :.|..|:.||.:..|
Zfish   210 P---LQSLPSFITPQQAVP 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 34/46 (74%)
rx3NP_571302.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 8/25 (32%)
Octapeptide motif 32..39 0/6 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..72 9/46 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..107 6/21 (29%)
Homeobox 110..162 CDD:278475 39/51 (76%)
OAR 268..284 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 272..285
Nuclear localization signal. /evidence=ECO:0000255 278..282
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.