DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and rx2

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_571301.2 Gene:rx2 / 30473 ZFINID:ZDB-GENE-990415-237 Length:327 Species:Danio rerio


Alignment Length:140 Identity:66/140 - (47%)
Similarity:81/140 - (57%) Gaps:18/140 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 KKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKHEPPRK 367
            |.::.|||||.|||.|||||||::.||||::|||||:|:||.|.||||||||||||||:.| ...
Zfish   134 KHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQE-KMD 197

  Fly   368 TGYIKTSTPPTATLNPGTLAP------------PFTSYPQTTTVTP----PGSMDSWTSYQTPYE 416
            ||.:|....|..:.|...:||            |:.|.| .::.||    ||.|....|.|..|.
Zfish   198 TGTMKLHDSPIRSFNRPPMAPNVGPMSNSLPLDPWLSSP-LSSATPMHSIPGFMGPGQSLQPTYT 261

  Fly   417 LTPQFSLLSP 426
            ..|.|...||
Zfish   262 AHPGFLNTSP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 35/46 (76%)
rx2NP_571301.2 Octapeptide motif 37..44
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..73
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..139 1/4 (25%)
Homeobox 139..191 CDD:278475 40/51 (78%)
OAR 302..316 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 304..317
Nuclear localization signal. /evidence=ECO:0000255 310..314
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.